CAZyme Information: POW15202.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW15202.1
• CAZy Family: GH37
• CAZyme Description: Glyco_transf_20 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A2S4W0C6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1102		123462.60	6.5870

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000086:169516-174068(-)

Full Sequence      

MELIVDSIFSSEDPDQNQIDLEPNTVLRKFTAGMYDRTQIHYGLAQERPDEDDWEPPQLD
GLPELHNIRHRIELIEDEIRSKGKLKLTGHVIMACHALPYLCNLQPTTPPLLSSPTSLEI
RPGDRLTHPQSLHSPTVTLPEILPSNSNRSLLGSNPTSITTPQPTGTTPTHNKQTTNNTD
QLQDQTFKWILEPRRGHAALNAGIKSLSNFRSITLCAYPADIRITSHPNSIPQPIEVNKL
TENQKISLDSGLRNLATTATTPSDEHHHQDGNKKGIQCVPVWVGDKSAGLHYEGFCKKYL
WPIFHYMPLSEHQDKTEENLAWKAYEEVNYEFALKIASVYQPGDLIWIQDYHLLLVPRML
RKILPKAHVGLFLHSPFPSSEFFRCLPRREEILDGMLGADLLCFQTYSYGRHFISACIRV
MGLESVGNGIECNGMITDITYCPIGIDADRIELEKQLPGVQPKMNALRKLYEDKKIIIGR
DKLDPTKGVLHKLKAFEYLLSNYPKWRNRVVLIQVTSPSPTDSPTLATKISELVDHINAT
YGTLHFQPVHHYHQTIERDEYFALLSVADLAVITSIRDGMNTTSMEYTICQEENKNPLIL
SEFTGVTGSMKSAVKVNPWDLGDVARAIDQCLNMSQEEKVERHAQLYSRVKSHSSSVWAS
TLLLQLLQCLRSDQTKEIVKLLDEEDMVAKYKQANKRLLLFDYDGTLTPIVKNPKDAVPP
EGLIEALGRLCADERNIVYIISGRDGSFLQQHLGSIPGLGMSAEHGCFLREPGTKDWIDL
TENIEMSWMDDVEEIFKYYEARTLGAFVEKKLSSVTWHYRNADPQFGLFQAKECQALLES
KKNIECRPAHTNKGEIVKRLLYTSPDVEFALCVGDDKTDEDMFRALKMLRSNASLEGHTE
GQVHSTTIDPPQTLSLYPILARSSSIGPGQQRSITEGGGAGTHTPIANKRPIRRRYSSNT
SMHTTYSCQNSPIPTGSPHPLNLLTANLNPTTNHSSQLMKTSSTIGSNSTNLHVLPSPKL
QPVQSVLEPQSIFSIVIDENMARKTLAEYRLDQPLMLVAVLDRLSKVSGSSTSAETASAS
TDTVVGGDVLLFIVTKKIITHV

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	262	666	3.6e-156	0.8547368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	275	661	69	457	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	278	886	73	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	7.81e-174	260	661	55	463	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	3.63e-162	278	883	164	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	8.49e-151	279	661	88	472	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR41528.1|GT20	0.0	21	924	6	949
CED83290.1|GT20	1.21e-265	55	934	10	873
UOP56917.1|GT20	3.44e-261	188	886	326	1092
SAM82706.1|GT20	9.95e-260	188	916	436	1240
AGJ01155.1|GT20	5.27e-259	188	889	5	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	1.45e-118	280	667	137	524	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUV_A	8.09e-99	262	669	58	470	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	8.09e-99	262	669	58	470	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVO_A	6.00e-97	248	669	41	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.06e-96	280	666	73	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	6.18e-166	182	886	52	770	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	4.60e-164	257	891	124	797	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q54NU9|TPSB_DICDI	2.11e-156	281	886	128	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9P4D3|TPS2_ZYGRO	6.62e-155	263	886	130	799	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	2.91e-151	182	906	30	794	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000001

TMHMM  Annotations     

There is no transmembrane helices in POW15202.1.