CAZyme Information: POW14166.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW14166.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1287	PKSL01000020|CGC2	140698.11	8.9621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000020:420374-428796(+)

Full Sequence      

MSSSPQKGQTEPAEGTLPHSGEAPTNSPEKPTKKLRKLRDDSSPRNRSSVSSFASSSSYV
LVSSRETFICETRPLEVPPNVIQAPVSVEITPTQPIRKAPLGPRKRSLPRPPAARAPIQT
RSRTAAALHSDLPLPSEETTDVFINPHFEEPSSPIVPVTVEGSSSSREPDSEECLAGFPE
PKQRSNDQMVIYVDSFPGVKNIKNPWNIFDSYTVPPSAFATPQPAAPKPAPRVDSPPKKR
RLSSRKAHRRAEWFTDPSRPKLDTIPEAPSLEVENEALCSLLLGAIGGAQAQNATSCRSR
KTKPHARITPIVSAYYPGYNAKFLPVENIPWKMYDHLQYFVAVPAPTPEGDLLIDTEQNM
VEVIAAGKKNNVSISLSIGGWTGSRSFSFLVGDQKNRTTFVGTIERAVKKYDWEYPNFQG
IGCNAINKNDSENFLAFLKALRAKLGPKFRLSAAVSMKGFMSADGKTYLTDVSEFAKVLN
FFTIMAYDVYGSSFSKLAGPNSPLFSTCSEPTQKFSVAQAIKQWTSTGVPARQLLLGIPS
YGYGYTLSSNKIVPSQFSGKAGVTSQLFQPHADTVPAGGKTAGEATGADICGTPNVAGGQ
WLFKELSETGKLSKNQKEGLNGYERHYDNCTHTPFLFPSTKNLISYDDSFSLKEKASYAL
EHGLGGVEMFDATGDTADSQLLKSVRKALLPRKKNSQHGLRCRNSNEQANSPEKPTKKLR
KLRDDSSPRNRSSVSSFASSSSYVLVSSRETFICETRPLEVPPNVIQTPVSVEISPTQPI
RKAPLGPRKRSPPRTPAARAPIQTRRKTAAALHSDLPLPSEETADVFINPHFEEPSSPIV
PVTVEGSSSSREPDSEECLADFPEPKQTMVFYVDRYPGVKNITNPWNIFDSYTVSPPAFA
TPQPVAHKPAPRVDSPPEKAEWSTDPSSPKLDTITEAPFSEGYNAEFLPVENIPWKMYDH
LQYFVAVPAPTPEGDLLIDTEQNMIEVIAASKKNHVSISLSIGGWTGSRSFSFLVGDQKN
RTTFVSTIERAVKKYGLDGIDLGKDPSPSRDDIYYCFITNHCDNKITLITTTDWEFPNVQ
GIGCNAINKNDSENFLAFLKLLRAKLGPKFRLSAAVSVKDLPDDVSEFAKVLNFFTIMVC
SSFPQADGFSHSEIAENILQMIDQAYDVYVSSLSKVAGPNSPLFSTCSEPTQKFSVAQAI
KQWTSTGVPAHQLLLGIPSYVPSQFSGKPGVTSQLFQPRVKTVPASGKTAGVATGADVCG
IPNVAGGQWLFKELSKQASFRKIKRRA

Enzyme Prediction     

EC	3.2.1.14:2	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	313	683	1.9e-52	0.9527027027027027
GH18	950	1247	5e-30	0.6216216216216216

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.26e-63	312	675	2	334	Glyco_18 domain.
119365	GH18_chitinase	2.37e-54	312	675	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	2.00e-52	314	675	4	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	1.66e-46	313	689	9	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	1.19e-44	281	689	16	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43393.1|GH18	8.98e-77	289	693	4	409
CAC35202.1|GH18	2.52e-68	311	689	50	429
UPK94240.1|GH18	3.69e-67	282	688	3	406
QKD60405.1|GH18	7.21e-66	311	689	33	414
QRV99381.1|GH18	3.86e-65	291	688	24	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.97e-47	327	686	15	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	5.10e-25	371	675	122	406	Chain A, Glycosyl Hydrolase [Niallia circulans]
1LG1_A	7.44e-25	314	666	11	333	Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose [Homo sapiens],1LG2_A Crystal Structure Of Human Chitotriosidase In Complex With Ethylene Glycol [Homo sapiens],1LQ0_A Crystal Structure Of Human Chitotriosidase At 2.2 Angstrom Resolution [Homo sapiens],6ZE8_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_B Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_C Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_D Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_E Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_F Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens]
1GUV_A	7.56e-25	314	666	11	333	Structure of human chitotriosidase [Homo sapiens]
4WJX_A	9.02e-25	314	666	11	333	Crystal structure of human chitotriosidase-1 catalytic domain at 1.0 A resolution [Homo sapiens],4WK9_A Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (0.3mM) at 1.10 A resolution [Homo sapiens],4WKA_A Crystal structure of human chitotriosidase-1 catalytic domain at 0.95 A resolution [Homo sapiens],4WKF_A Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mM) at 1.10 A resolution [Homo sapiens],4WKH_A Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (1mM) at 1.05 A resolution [Homo sapiens],5NR8_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound 7a [Homo sapiens],5NRA_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound 7g [Homo sapiens],5NRF_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound 7i [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	3.85e-24	371	691	154	452	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.49e-23	314	666	32	354	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P36909|CHIT_STRLI	1.49e-23	368	678	328	597	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
sp|P11220|CHIT_STRPL	4.38e-23	371	689	332	609	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2
sp|P07254|CHIA_SERMA	1.51e-18	371	689	265	556	Chitinase A OS=Serratia marcescens OX=615 GN=chiA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000004

TMHMM  Annotations     

There is no transmembrane helices in POW14166.1.