CAZyme Information: POW13688.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW13688.1
• CAZy Family: GT10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708		82033.57	7.4095

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000023:539185-541854(-)

Full Sequence      

TRMANPLSLRSKSLTLPPVQLQHINQRQPFSQVVTPGLKREEEGEGQEERNSSPALNTSN
LSYFPVTRSAAYSRIPASSEEGEGELPTSSSKKHSTRLRVIRIHPIALLPAFILGIITSL
YVCLQDSSSPSWSKLIFKQQQFNIKTEPVINHRDHIYLPYDYLNHTWTLNPSKDQYPILQ
LIHNASLAWHDKLNRQSKNIQDAVVEYQRRYQRKPPKGFLEWFNWAQENQVKLVDEFDRV
NELIEPFWAIPPNVLRNRTEEAGKNEAFSTFIIKDGTVKPIGSKKDVGRTIDQLKLLEVI
VPHLPDVNVTMSHHDGPSVFMDWKTKQRHLDHARAGKVLPPELIDRVEDDASLWGFVGAC
SPDSPMRMLANGLGQELKVQHAGPGGYIGLDHSKTMDLCQHPEWQEFHGFTAWAGPRPLP
LRPIFSFAQSPGFVSDILNAPLEQFEDSTKNADQVKKWEDKLDNQRLLWRGQTTGVWFDR
QTNWRKSHRVRLHRLGVASKHPYGHQLKRKLRTPALIYPSNNHSTLNDHQVQVVVVEKEY
SLAQLSDRYLSASFVGDLVQCTVEDSSCETISKEIEFADPVDWQFQNNFKYVLDVDGNSW
SGRFRRLLKSNSLVFKSTIWPEWYRDQIQPWYHYIPVRIDYDEIFDLMNDQKFKTEGFDH
LAKSIAQNGSLWADEHFRYQDIRAYVWRTYLEWARVSSDDRDSMNFEL

Enzyme Prediction     

No EC number prediction in POW13688.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	420	696	2.2e-51	0.896

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.74e-13	571	685	128	241	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.30e-09	586	695	213	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40913.1|GT90	1.98e-156	102	706	153	752
CDR40950.1|GT90	7.72e-110	176	707	169	703
CDR40393.1|GT90	1.34e-102	176	702	114	637
CDR48932.1|GT90	2.59e-102	176	706	171	694
CED83568.1|GT90	5.09e-100	169	708	167	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.00e-10	542	698	196	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.04e-09	578	692	261	373	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.39e-81	171	703	147	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	7.89e-10	542	698	224	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.45e-09	542	698	224	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.45e-09	542	698	224	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q8BYB9|PGLT1_MOUSE	1.01e-08	542	685	224	358	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

Start	End
100	122