CAZyme Information: POW12261.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW12261.1
• CAZy Family: GH7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		71116.03	9.1509

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000032:76502-79305(-)

Full Sequence      

MARHFLIIPPRPHTLLTCVIFLSTLGLLFYLPWIKIRARTCIPAFRRPAPPIFFNTENGL
LVFASPILNDTHVKHPIESLIINAQTEWDRVTRRQSKTLAMAVREYQRRNHQRLPPRGFE
KWWQFVVDNKVGLVDEYDQISKDLEPFWAIEPARLRKLVHNLQTKLNDRRLIFEVDSEGR
VNRTGAFGNTGRAKDLSALMESYQKYSRKATKPFTMVIGADDQAEIKTTWRERSRLLELA
KRQEFIDEEEDLQLSETHSAYDDCPPHSSPRSLGNGYSSFVFDHLKSMDICSSLEQVPIH
GSLVNRHSTAFQPITPLFSFSKTCLDSDIRVTPMEQYQATYGNVYEWNDPRRIAKSFWRG
STTGVSGSKAIAYLKRKLIRAVFNGVNAFLSSLSTNEKNQTLHSNENPSWKDSHRLRLHQ
LTRPIKGHKQLIDGTQIDLAKANAAWFDVEFVGTPIQCEPPVCQQLEQMIKFQEWVDDDK
ANLFKYALDVDGNGWSGRFHKLLSSNRVIIKNTIFPEWYADRIQPWFHYVPVKTDYSDLH
DIIHFLKTHDDLAAQIAQNGRDYSRRYWRPQDMAAYMFRLSLEWSRLYNREICDRSKKGT
CESLDFDLKLL

Enzyme Prediction     

No EC number prediction in POW12261.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	308	588	8.8e-55	0.908

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.56e-18	484	587	146	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.84e-12	484	604	216	341	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40950.1|GT90	1.48e-109	51	610	145	706
CDR40723.1|GT90	8.40e-94	58	591	198	708
CDR40913.1|GT90	5.27e-92	73	587	240	742
CDR40393.1|GT90	5.63e-79	75	591	114	635
CDZ97802.1|GT90	1.57e-78	74	587	99	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	7.65e-13	484	595	237	349	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.07e-08	484	592	272	383	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.64e-66	75	587	152	655	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.40e-12	485	587	363	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	3.71e-12	484	595	265	377	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.94e-12	484	595	265	377	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.06e-11	484	595	265	377	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

Start	End
12	34