CAZyme Information: POW12044.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW12044.1
• CAZy Family: GH65
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
956		105931.61	5.9934

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000034:95971-99852(-)

Full Sequence      

VYGMSQFNRNQENSHERTPLGGEPTSPFITSLSNGDPSRLVSPLSTYSPNSFFLQRERSN
SPPQSTRDLLNTFPSPAIPSPGQAFLSPSQPSTSLRNHDNELLPITSASAIPAGEYLDHY
SSNSATSGENQSPHFPPSSGLGIAESTKKTCSANLRNPQENPRNSERFSVQDVEDLYESR
PHSLEKSQRLSQLRPCQAAFHDAAPEPIEFQRQKMSDLESKAQKVWAGTSMLRQSSRNSS
SSNQGWRQSFFGKFGGTDDISHYAGLSEPMGVDGKNKDKLEELQDLPARKDSSLSIMVEG
RQVNRSHDTTFVMNMAPDQSNPSASFMRPISMAGDQNLKMMRGDRLDPNPTAMRFFPPMN
HSDSMASVSAASLISGTESRLFNRFGHSSMSEDFTIKEDEERLGYLPHSLDVFDFRDAEV
DDELHDPGPVLPRKGVDRLIVESKAVSGQTDWFSARGWLNAIGLAILSITLVSLFAGFPI
IDYFIKHPIGTLGGFNLGGINATGQVPQIFGFRGLIDVDTPREARSKKGTDGRYYQLVFS
DEFSQDNRTFWPGDDPYWEAVDLHYWATKNLEWYDPDQITTRNGSLVISLDRAADASKNH
NLDFKGGMLQSWNKFCFTGGIIEASISLPGDPKAGGFWPACWTMGNLGRAGYGASLDGTW
PYSYDTCDIGTLPNQTDPKTGGPIAAKTMGDPYHDNVLSYLPGQRFSRCTCPRNSGKNYH
PGPKHPDGTWVGRSAPEIDILEAITDPDTKQGQISQSVQLAPYNANYRMNNGTAGYVKVT
DNPFQTVLNPYTGNIYQQAASGLSNTDQTSYGGKGFANYGFEYATSDEASPFITWTQKDQ
AMWQLTPGALGPDQLRLPLFHAKLLTSIAETLQYFRTIQPRISSTFARLTRKSSPACADE
VDWVRHRIPNLTTWAQYQQAHGDDTGNAKTGFPKINFLIRVEIIPYGFEETYRRQI

Enzyme Prediction     

No EC number prediction in POW12044.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	541	854	1e-106	0.8558282208588958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	1.18e-178	417	853	7	401	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	2.33e-109	537	853	1	247	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	4.23e-32	514	837	28	286	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	7.88e-14	539	663	1	113	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	0.001	541	657	1	102	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB75891.2|GH16_2	1.39e-150	401	854	343	777
ADV23033.1|GH16_2	2.67e-150	396	854	338	777
QRW06829.1|GH16_2	3.54e-148	419	919	215	728
QRV77885.1|GH16_2	3.65e-148	419	919	216	729
QRV92705.1|GH16_2	2.98e-147	386	919	187	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VY0_A	2.27e-07	531	652	9	132	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P87024|SKN1_CANAX	2.96e-84	304	853	108	639	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P32486|KRE6_YEAST	3.79e-83	383	853	181	612	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|O13941|YEPB_SCHPO	4.70e-83	415	853	128	526	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P33336|SKN1_YEAST	3.34e-79	303	853	141	664	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87023|KRE6_CANAX	1.62e-77	327	853	151	642	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in POW12044.1.