CAZyme Information: POW10072.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW10072.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1052		118691.53	8.7066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000049:242901-247692(-)

Full Sequence      

LLDWAPSEKPCGRQAFGKKRYKARQVYEGEAIWLSQINHRRKKAPDFVELFSGPISEKDA
LLRAMVGFFTTIDSLLQPFLRGPPLPSTTLHFSTLKWSLANANRSIQVSTPFLNQPHLAL
VKAGLIDEPNIGLNEGTTRWVGEEKYWTWETKFELSHAEEWQDVNNFYLIFNGLDTYCDV
QLGGEQVGSTDNAFRSWVFDGKAVNFRLTLTDSNMFSCAVTGIIRKNRNKSIPMTLRFDS
AWATATRLANQAGHTWFPPGSSGSNGRRATTVLRYEYSSRNWARKQQSDFGWDWGPAYLP
SGPTQPAYLIGLSGPGPPSIKEMNLHRGIQKSAPLRSSNGNADHHNGVVLQVQKRRNNRE
NLVRHDADSPPLMWVHRSLIDIYRQGQRNNLPPNQSAPWIVNITLPVTSPRPLSGYKPTL
SASFPGTSIRLPTVQLTMLQPAKYRSFGPNSLWTAEFVIQPDAVELWYPSALGNPKLYDL
KLTLEFAISTLIMKFLEGSDRALDLPSKLTGAVLRTRFKSLLPWKCSMIPIDTFAARTNS
TTIRWLVESALLAHQNVIRTCDELGILVWSEAVFACAAYPISPESFLDNIRAEVSENVAR
LSRHPSTALWAGNNEASCGEGYLMDVKHTWPNGSVYFDQYDYLNNHVIRDLVLQNTRSAS
YIPSSTTQGYLSLEPYVSRYGASTSGELYGDQEHYNYDTSISFNTSSYPVARFVNEFGFH
SLASIYTLDRILQSEEDYHFNSSVIRAHNKNPPAGSLEYPYPADRGQNSLMTGVTRYYPT
PNITGDARALGLMPAKVRPCLRLSWDGNRSTTEVDTNLVFKLLSWPLKLVTIDWVPAGVK
GIWVRFIGNLVIDRIYGPMEDLSLSCSARSEPCDHNPNIHVKNETLDIYVTSDLWEDARG
TAQLSWYDFAGHQLSKASKEFIVGPLNSTRLLRTSGLSAIVPNGHPPHDAWLHLTLTTND
GKHANEQFFHPVKLKDCLLRPTKVSFGPLDIIRYLCKLLMDMKTNQASNAIFLRPNETRN
LEFVVKSYDHPDLTRNLESKMVVRTMWDNQHR

Enzyme Prediction     

No EC number prediction in POW10072.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.53e-15	455	752	241	544	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.84e-15	884	976	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72430.1|GH2	8.03e-114	64	789	50	747
SJX62291.1|GH2	2.24e-112	64	789	50	747
CDU25759.1|GH2	1.16e-107	54	782	40	752
BCS16350.1|GH2	5.02e-104	93	943	28	807
BCS04781.1|GH2	5.02e-104	93	943	28	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	1.48e-83	96	932	37	804	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	8.71e-40	97	751	18	579	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
5N6U_A	3.45e-32	117	750	53	565	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VQU_A	6.92e-27	117	986	35	766	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]
2VJX_A	1.20e-26	117	986	35	766	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QWU9|MANBA_ASPNC	4.34e-103	76	959	7	819	Beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndA PE=3 SV=1
sp|Q0CI48|MANBA_ASPTN	2.11e-100	95	1048	31	927	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2
sp|O74168|MANBA_ASPAC	3.56e-95	94	976	31	850	Beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=mndA PE=1 SV=1
sp|A1DMT2|MANBA_NEOFI	7.76e-94	163	988	90	857	Beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndA PE=3 SV=1
sp|Q2UN00|MANBA_ASPOR	3.74e-92	93	979	27	830	Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in POW10072.1.