CAZyme Information: POW09895.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW09895.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1029		115869.47	7.0101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000051:76136-81082(-)

Full Sequence      

MKLRFHSLLTLSLGVVQTQFRIAAPPSLGASDSESPSVVSWDRHSMLIEGERVFIQSGEF
HTWRLPVVSQWTDILQKFSAAGLNTVSIYGKGLVNPINGTTDWQGFKSLQPLFDAARSAG
LFVIVRPGPYINAETTDRLTKWYGHCVQVENEYMTDAHSSLGQPSGKDQYMQDLADALLD
KGIVVPLTVNDAGMYRNFATGMGAMDIYGFDSYPQSFDCSKPNQWKPVVETYKKYQDSLH
LKSPLFIPEFQAGAYDSWGATGYENCRKLTGPEFESVFYLNNLAANIKMINYYVSRYVIW
WNKLGQLAFPGTYTSYDYGSAISEDRTLNEKYTELKRQSLFLRSSKEFYETEVVGDSKHD
PNYFEAGDKNSAVVTELRNPTSGAGFYIVRALNSTSIKPTNFTLNVLTSVGLKQLPQITL
LPRESRLLVTDYRTSPKSDGPGVPHPIQLLYTTSSVLLSAHIGGHQVLYLFSNSDGRESQ
ASGDAETSSIKIPDLERGYFTKSFPETGQPPSFQISAGDDSHGYREINWRVRDEGSIFAL
GSQSSVVLITSKAMAGEVWNPILAQSDPSKPSSSVLIWGPWLVRNASISITDNTQRKILR
IWGDFEEGSKKEVLIFVGGLSIGEVEWNGKTVENLARAPESSFLSFIYHPNSFKTYMQNK
SNNQLTHVGSRIDFRTLKWRYQDSLPEIKTGFSDDQWTEATIEKSNNHYKKLYGKYYLYA
CDYGFCNGATIWRGHFLQKCQSSFQDQHEAHPNAQVDSPMGINLTIAGGDFFAASVWLND
IFSEAFRMSSPNRTPRHFIFLLAHSKNAKLTSSQLSKIRWGWIKLRMLNTPEGSWAINSK
VKALRAALKKSPGRYKDILAVFTNPERGIYNENGFYGMRSGWHLPDYVDEPDNLNWKKLS
PIEDGLKTAGIGFYSTTLNLDFEQGYDVIVSFQFQQPSVDEGRYRVEFWINGWHMGKFVS
HLGPQTRFPVHQGILNYQADNHIALTLWALDDEGAKISGLELVVDKILEGGIGPIENHHP
PYDSSRRHL

Enzyme Prediction     

No EC number prediction in POW09895.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	147	337	8.2e-22	0.5244299674267101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.06e-45	45	337	1	313	Glycosyl hydrolases family 35.
404274	BetaGal_dom4_5	6.92e-31	876	993	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
402180	BetaGal_dom2	2.21e-19	370	470	16	111	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	8.24e-15	370	553	17	178	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
224786	GanA	3.02e-08	39	129	1	90	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW00634.1|GH35	2.77e-173	29	1024	31	1003
QRV86584.1|GH35	5.90e-172	25	1024	27	1003
QRW15140.1|GH35	4.53e-171	25	1024	27	1003
QRW27580.1|GH35	1.67e-170	24	1024	24	1001
QRW10069.1|GH35	6.21e-169	38	1011	67	1072

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OG2_A	5.32e-121	25	1002	10	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
5IFP_A	1.27e-120	39	1027	46	1004	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
1TG7_A	1.93e-120	39	1027	6	968	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFT_A	3.42e-120	39	1027	46	1004	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	1.07e-113	38	1027	45	1002	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XXE7|BGALE_ASPFC	6.11e-123	20	1026	15	1008	Probable beta-galactosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacE PE=3 SV=1
sp|Q4WG05|BGALE_ASPFU	6.11e-123	20	1026	15	1008	Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacE PE=3 SV=1
sp|A1DJ58|BGALE_NEOFI	1.20e-121	38	1026	41	1008	Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacE PE=3 SV=1
sp|A2QAN3|BGALA_ASPNC	5.77e-120	39	1027	46	1004	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|Q700S9|BGALA_PENSQ	2.35e-119	39	1027	46	1008	Beta-galactosidase A OS=Penicillium sp. OX=5081 GN=lacA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009941	0.990040	CS pos: 23-24. Pr: 0.9397

TMHMM  Annotations     

There is no transmembrane helices in POW09895.1.