CAZyme Information: POW09530.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW09530.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		87709.98	7.0507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000054:129274-132993(+)

Full Sequence      

MPNSKRHLTTAMASKSSGKTTATFGAAPIRSGFRTSLALALTSGLGLYLYLYSHRPIPHE
TARLPVGESVEEFHTWTEEMSGPGFSSSASSHTAAIISKDDAPVGVPDMNTTYTPSQLMS
LPILHHTFKDPFDRRNGFKPLRDSKSPWLATSANGAILIKHLNRNRFPPSESIDSSRGSV
PPPAPIWPPHQLLKEKKNSWNTPISPHMVTGLNTSYLWEGRERIQEGTLPKIQWDGFDKP
NWEEQSDRINRLERQGWVKRGFQHVWEGYKARAWGHDELKPVSGSFQDPFSGWGATLVDC
LDTLLIMNLTREYNYARTHVKAIDWAYTVGKVDSWAPSSSDRPKISFFETVIRYLGGLLS
AYDLSGDKLMLERAEENPHGGQVGRVMTADIGSLTLEFTRLCQLTSKGYYYDVVHKIIDL
MDGNQWTSSNRLGTLFPIIIDPDYPQSLDGRYTFGAMVDSYYEYLIKQYQLLRGTNSQYS
RMYNSAIKSARKYLVKTFNLEANGGKNLTVIGDSISGGFVPSLDHLTCFSGAMIGLGARL
LSSEQDLDLALRHADACVWAYESTKTGLGPEEASILTTDDSAQWQPVVYKGKIHRELKPA
YRSGASIHNPNYLGRPETIESLFYMWRITGDRQWQDRGWRMFTSWLEACVTKFGFANLED
VNSWPTNTIDKQESFVLAETFKYYYLLFSDPDLVSLDDFVFNTEAHPLRIDNPGKVIKRY
WDGRPDESIDKMFDPPGIKEGERGYGTFLQQWSRVDLPKLNSEERQVYNRVMGIL

Enzyme Prediction     

No EC number prediction in POW09530.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	381	710	4.8e-97	0.6860986547085202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	9.08e-171	262	710	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.90e-118	253	713	71	521	glycoside hydrolase family 47 protein; Provisional
403188	Nup192	0.003	435	496	1373	1441	Nuclear pore complex scaffold, nucleoporins 186/192/205. This is a family of eukaryotic nucleoporins of several different sizes. All of them are long and form the scaffold of the nuclear pore complex. Nup192 in particular modulates the permeability of the central channel of the NPC central or nuclear pore complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR39313.1|GH47	1.93e-140	220	755	318	925
SAM84424.1|GH47	4.34e-137	228	744	222	774
CDU25238.1|GH47	7.19e-136	138	737	81	764
CDI56918.1|GH47	8.41e-135	229	744	413	964
SJX63956.1|GH47	4.71e-134	138	741	81	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FO2_A	3.30e-69	254	713	10	459	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	5.18e-69	254	710	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	6.05e-69	254	710	10	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1X9D_A	1.16e-68	240	713	74	537	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	1.50e-68	254	713	5	454	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C512|MNS1_ARATH	2.77e-70	246	710	90	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	2.54e-68	222	751	79	572	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	2.35e-67	181	713	165	698	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	1.42e-66	253	713	206	656	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|A2AJ15|MA1B1_MOUSE	2.76e-66	253	710	207	654	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000026

TMHMM  Annotations     

There is no transmembrane helices in POW09530.1.