CAZyme Information: POW09017.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW09017.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		87539.57	6.4678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000059:354365-357225(+)

Full Sequence      

MTILAHFVLFWLGIALPAWSTSHQNSTDSSYPTRFRGVRWDNEQWKLVNTVLEPGRYQSR
ISLANGYLGINLAALGPFATIAGFYDYQLKLNSSNFPWLNQYGGESIISGIPHWAGLLVK
TKSAILDASTDPTQIRNFQSSLDLKAGLMRWKFDWVLDGVQPMISIEYTMFVNKLHINRA
AVQLKVKAAGDIELRVVDLLDGECAVRTDLVEKHHHSNSSTICSTVSPDGMAHLTGHVCS
SLRSKAFSRSELFEGLPQLTDHSTSTIAQSASLKLKREQSVVVEKFIGAASGDAFSNPQA
IALQSALAGADDGFAAQLDSHRKEWSSIMTEDSVDDYVELQILAITNPFHLLQNTLSSNA
IALSDNSTALDNWSISAAQRIINYRVAQFPQAQENLKMAYSSSQNQTNQFSPGDAIYPWT
SGRFGNCTASGPCFDYEYHINGDIGLSFYHHLVATGNFNSFKRNLLPIYQAIAGLFSNLL
SETSDWKYGLRNATDPDEYANHVNNPAYTMFLMKHHLITANELGNIFGQKTNPIWSKQAE
NLALPIDNQTGIILEYEGMNSSIEVKQADVQSLNGPGMTYGVYSVVENRFQVSGCSSYTY
QLLSSQPYVRAPWFQFSEQLVDDYSQNGGTHPAFPFLTGMGGDYRVTVYGYLGLRLELDH
LRAIPDADPDYADAPIPVKLRSSTRTLKLKPQHTLTVPNRAVYMSNPLQCAPIKSDQAFH
PGQFPISIADGSSATRWVPSDLPATITVQLNEHFRAKSIIDLVSNLPTSPNFASASSTIP
PKLSGLSSLLTRP

Enzyme Prediction     

EC	3.2.1.28:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	376	569	1.3e-38	0.521505376344086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	1.44e-47	43	558	9	564	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
397616	Glyco_hydro_65N	3.72e-34	55	291	11	239	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
281612	Glyco_hydro_65m	1.38e-14	377	558	53	245	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW95062.1|GH65	1.29e-236	29	754	21	888
AQA29363.1|GH65	1.85e-222	27	754	16	884
SMR48299.1|GH65	4.49e-222	31	760	18	889
UJO19712.1|GH65	5.22e-222	27	754	16	884
SMY22156.1|GH65	6.34e-222	31	769	18	900

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	3.38e-16	43	657	22	643	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	4.86e-08	376	664	359	703	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B5H9|ATC1_ARTBC	4.61e-186	31	759	53	927	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1
sp|P78617|TREA_EMENI	3.84e-177	23	750	45	911	Acid trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treA PE=3 SV=1
sp|Q5AAU5|ATC1_CANAL	4.82e-73	63	657	159	794	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|M1RNJ8|ATH1_CANGB	3.25e-69	35	655	157	862	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|N1P212|ATH1_YEASC	3.67e-65	35	670	121	837	Periplasmic acid trehalase ATC1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=CENPK1137D_1727 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999777	CS pos: 20-21. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in POW09017.1.