CAZyme Information: POW08499.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW08499.1
• CAZy Family: GH18
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A2S4VG71]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		47615.24	8.1852

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000136:154957-156961(+)

Full Sequence      

MRSPCPTLLEAFLLVALLIAVNTDARRAKGEPKVKGYYPTYNSEAQPPSKIDWAAYTDVL
YFMVIPQADGSLSFDPALTPSQGEKLVTEFVSQARKHDVNPLLSTGGWTGSQHFSNLTAT
APSRKRFAQVLVNFAKKHGFTGLEMDWECELDKLEPNLNLPLAIYPLADPNGDGIGCNSR
NPDDVVNFGLLTKELRTLWPEVELTAAVGITGLNGADGSPATPKETALLTANLDYINLMA
YDVFGSWSETTGPIAPLYATCAPAGAAQSVETGLQVALKQGFKASQVLLGIPGYAKRSEL
ASPKLVPKVVGSHTTLYYQKPTGVTPPGGKFDDKPGKDICGNAQKWGGSFLVTELISNGW
LSKDQKTGLKGYKRYFDECSGQPFLSNGKYLISYDDKDSTIAKAKFAKKNNMGGIYFFDT
MGPLQILYKRPERSSRNQ

Enzyme Prediction     

No EC number prediction in POW08499.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	33	419	3.3e-46	0.918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.24e-55	33	419	1	330	Glyco_18 domain.
395573	Glyco_hydro_18	3.71e-54	36	419	4	303	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.89e-52	36	417	3	316	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	2.60e-49	12	419	15	419	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	6.35e-42	98	415	66	333	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	5.39e-208	1	423	1	406
CDR43393.1|GH18	2.41e-71	32	428	24	398
ALL41259.1|GH18	1.14e-64	239	429	1	192
CRX79101.1|GH18	7.47e-62	61	416	6	336
AYA60264.1|GH18	1.55e-59	7	422	3	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	6.88e-32	48	415	14	347	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	4.28e-30	98	422	122	405	Chain A, Glycosyl Hydrolase [Niallia circulans]
5GZT_B	2.12e-25	19	419	264	624	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6KST_A	3.36e-25	30	419	5	353	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
5GZU_A	4.53e-25	33	419	27	373	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	1.52e-28	98	422	154	437	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.77e-22	48	414	43	354	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|A5FB63|CHIA_FLAJ1	5.57e-22	13	414	7	437	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
sp|Q9WTV1|CH3L1_RAT	6.55e-20	93	414	82	346	Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3
sp|Q9D7Q1|CHIT1_MOUSE	2.24e-19	102	414	93	352	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999777	CS pos: 25-26. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in POW08499.1.