CAZyme Information: POW07497.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW07497.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		46533.84	6.4142

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000074:168414-170313(+)

Full Sequence      

MAEYFDYIVVGGGTAGLTAGGTGINRPSISIPAMMATNLHTDIDWDYSKVPQEGANQQKI
SYPRGKVLGGTSSINAMLSTWAEAEDYETIERLGNPGWGSKEIEKAFKKTERLINPPLNS
PYIFNPGNHGIDGPVTNSFPKFIPPQYLPYFPACAAAGHVIQDKDSFAGNMEGAYIYPSA
IDEKGFRVTSATAHYFPIKSRSNLIVRTDCEVDKLIVTSTDTTNSRITILGVEYYSSGTL
GRAMVRHEVIMSAGVIGTPVILERSGMGKESILKPLDIPIALNLEGVGSNLLDHLRVTSS
YRLKAGHKTVEDLFRDPDYAAQQKSIYEQSGGGLLSHWFSVADFQSLKSFVGEDGMPQGM
KLLEDCPSCTSPSQFDAVVNRIKNGRAIEFSLVNAFIVRDQLQSTPRNHLILLAVNCQRL
KIGNDL

Enzyme Prediction     

No EC number prediction in POW07497.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	418	4.1e-85	0.7394366197183099

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.77e-38	29	304	48	309	choline dehydrogenase; Validated
225186	BetA	1.83e-32	44	307	63	316	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.73e-22	55	295	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.12e-07	64	293	127	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92638.1|AA3_2	7.70e-53	3	354	23	381
QRW27344.1|AA3_2	3.62e-52	1	365	10	399
QRW13132.1|AA3_2	2.86e-51	5	374	37	428
QPC70868.1|AA3_2	3.79e-50	3	354	22	382
CEI62186.1|AA3_2	5.25e-50	3	354	22	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.18e-34	5	316	2	333	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.20e-34	5	316	3	334	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.08e-32	5	336	6	353	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	4.47e-32	5	310	6	335	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZH7_A	4.45e-28	1	293	4	305	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.74e-42	5	406	14	434	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.74e-42	5	406	14	434	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	7.81e-41	6	393	15	439	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q47944|SDH_GLUOY	3.46e-35	1	304	1	303	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.38e-32	6	354	41	418	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995979	0.004049

TMHMM  Annotations     

There is no transmembrane helices in POW07497.1.