CAZyme Information: POW06589.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW06589.1
• CAZy Family: GH26
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		44975.68	5.2459

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000084:194571-195968(-)

Full Sequence      

MLVVYTLFAALHLFSGTDALVVRAESKPTLSGYYPGYHSTLLPPESIPWDLYTHLDYFVA
TTGSEASEDLKIENEENMKAVVAGAKSHGVSISLTVGGWTGSKYFSKLVTDEDSRKTFAQ
TFKKTLDKYGFDGVDIDWEYPNVPGNDGNILSPNDAANYLQFLKTLREVLGPKARISAAV
SVHGFMGPDGSYLIDHKPYAEVLDFITIMAYDLYSPSSTDLAGPNAPLFETCNDPTVKVS
VAKAIQTWTSTGFPASKILLGLPAYGYKYTMLTSELTPTKFSGQDNLTSLYFSKIDKSVQ
VPTPNATAAGPTTCGGEEEGHTWLFKDLVNCGLITPDGSQGLKGYTRYYDHCSRTPFLFE
SSSKTLISYDDARSLARKTRFVKENGLAGVNVFDATGDTQDRVLLKAIQSSL

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	31	403	2.4e-64	0.9425675675675675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	5.63e-73	32	398	4	334	Glyco_18 domain.
119365	GH18_chitinase	1.13e-67	32	398	3	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	7.33e-63	32	398	4	307	Glycosyl hydrolases family 18.
225862	ChiA	4.56e-56	32	412	42	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	6.27e-51	44	412	20	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43393.1|GH18	2.16e-91	22	412	18	405
CRX79101.1|GH18	5.14e-82	57	392	6	337
CAC35202.1|GH18	4.03e-80	31	412	52	429
QRV87962.1|GH18	3.83e-79	25	412	119	504
QRW02133.1|GH18	6.42e-79	25	412	153	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	9.27e-52	44	409	14	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6BT9_A	1.77e-36	48	398	118	448	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
1ITX_A	1.00e-34	94	412	127	419	Chain A, Glycosyl Hydrolase [Niallia circulans]
5Y29_A	1.10e-30	31	389	17	342	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	1.33e-30	31	389	17	342	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	6.35e-33	94	412	159	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	7.94e-30	33	393	34	360	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|A5FB63|CHIA_FLAJ1	1.51e-28	90	411	112	462	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.71e-28	44	393	43	358	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q6RY07|CHIA_RAT	1.63e-27	33	402	34	374	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999694	CS pos: 19-20. Pr: 0.9724

TMHMM  Annotations     

There is no transmembrane helices in POW06589.1.