CAZyme Information: POW05553.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW05553.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	PKSL01000097|CGC1	49264.41	5.9697

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000097:137445-139003(+)

Full Sequence      

MAFWKEAVEKLKDVQSTSIEQFGEPRFNDQHAYYPTTDLSSGGAANNQGRFIIRNPATAQ
LEVEGTGEVVRFASLCAPALFDNEGWEKEDTMRTISHFGKWPVTRTYTLKIKSTRIGKGH
INGWDPEAEDFLYDESMFISIDHTIALAAKYNVRLIIPIINQDYGSEDTNWVGNFSDLIR
HRRGSRQDSEGQDWWKDGECLDSMKKIVSFLLNRRIGDDPTILAFETGNEMNFGGKRPAP
GEWTLEIARHIKNLAPRALVMDGSFARTDETPHRHDLQALHSELVDIISYHYFGHGDTRF
VEHDVKAAREHGTVFVVVEYGFLASAQQFESFLKDCDRQGVSGTLAWSLHGEEFTWKGVA
WADYYELWTNLCREGDNEWKSLSELTDNIKAGHLKHSCANILKLKDCAMLLLAMRGISPD
KLPGPFSKPLRIGR

Enzyme Prediction     

No EC number prediction in POW05553.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	89	351	3.2e-38	0.96875

CDD Domains     

POW05553.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43041.1|GH5	9.48e-86	67	349	61	356
ALL41339.1|GH5	2.95e-46	120	349	6	271
AYQ73430.1|CBM23|CBM61|GH5	2.53e-29	71	366	76	386
ULT56171.1|GH5_41	3.65e-27	71	349	21	290
QGG54903.1|CBM23|CBM61|GH5_41	2.45e-26	71	365	81	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	2.68e-10	138	326	99	314	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	4.30e-10	138	326	85	300	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5W6G0|MAN5_ORYSJ	1.20e-06	132	264	150	285	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|O48540|MAN1_SOLLC	1.78e-06	132	291	99	263	Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum OX=4081 GN=MAN1 PE=1 SV=2
sp|Q9LW44|MANP_ARATH	9.93e-06	133	263	103	237	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3
sp|Q9SG95|MAN4_ARATH	9.93e-06	133	263	103	237	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000003

TMHMM  Annotations     

There is no transmembrane helices in POW05553.1.