CAZyme Information: POW05063.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW05063.1
• CAZy Family: GH16|GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	PKSL01000103|CGC1	63756.71	7.1039

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000103:117741-120734(-)

Full Sequence      

RYHLTTHSVQSISNLGSRLGILRSTASSKDPQVVHSQDGYLYLNDNMYRNQPVIHPIISL
INNATRAWNLKLESQSKDFTTAVSEYRRRNNRNPPKGYDRWWTWASKNNVKLLDEYDYLH
NSIKPFFALPPQVFRQRASALVNQQTKWSFMIFVVSIRKGQLSLSGQQANIGPRPNEMIE
LLKDIAHLLPDMDIPISGEDLPAVSVSARNYEHHIDAVRNSTFLSPHDLEDIKDHHGLYG
WSNTCSTQSELHKYLDGLQDLSSLSRIGVGQSYIHDPLPLPTFTQPKVHQFFPLFGFTKL
NGFAELPLSPPSQFNQEMGTDLSWEEKLNKLFWRGSTTGTFFSAINNWRMSQRTRLVKFS
NEPRGNVTVRKTDSQDNLEYFEGDTRELNEKYFDIGFTNTPVQCDINDGSCQAIQNGYVF
KPFAEPSTMNRFKYLLDVDGNGWSGRFHRLMSTKSAILKRYADRVQPWYHYIPVKVDYQD
LYDIMAFFLGDPNGLNGHDNLGKQIGQQGQEWTQEYWRMTDMQAYMYLLLLEYSRLLNRD
PEDLYSMDYL

Enzyme Prediction     

No EC number prediction in POW05063.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	287	537	3.2e-59	0.912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.81e-19	316	526	72	242	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.61e-11	292	530	123	316	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40913.1|GT90	1.22e-104	55	549	242	752
CDR40837.1|GT90	4.53e-103	54	549	575	1096
CDR48932.1|GT90	1.77e-102	52	550	168	695
CDR40393.1|GT90	1.02e-101	55	548	114	643
CDR40950.1|GT90	2.83e-99	52	549	166	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.49e-08	431	538	236	343	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.04e-71	46	550	141	668	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	6.60e-08	431	538	264	371	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	8.76e-08	431	538	264	371	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.16e-07	431	538	264	371	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.04e-06	431	542	361	472	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in POW05063.1.