CAZyme Information: POW04354.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW04354.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		52499.54	7.5861

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000112:147309-148846(-)

Full Sequence      

MYPTLYRTWSLSPSKHAQAWKYIFGFMLTLLATSMLVIYRVREPINSAPQRHILLEATNS
PSPDISSSQTSTDPTLDYRRFLELTTSPKNFNQHHPTLGFGHIYCISLPNRKDRRETMTK
ISAALGVKITFIDAISKDHPVIGWIGERASEVRKKKLELMSQYSGLEKEKIGGMGAGSVW
LTVNNGRNANQDSLRNIKLPSLAGAQPEFEGKNWVDYLWSVSDHHTLTSSNPDFNITAEM
WDPQEKMLPRQINAATVSTYYNHLRVLRTVSESGEASALILEDDVDMEWDLERRWRSIER
HLPSDWDTVFLGHCWGHELIQPQFGHPNLHKSTEPLCLHGYAVSSLGSKKLVELYSDPWT
SFQTPVDTCIPTFIKLGLNSFSVEPTIINQSKVLESDIQSGKGSNWKGLLVDSVAQRILK
SEGKTMNESLNQNDSKSNPDPATLFRYKSVFTKALKDVQCTKDV

Enzyme Prediction     

No EC number prediction in POW04354.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	102	369	1.1e-23	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.21e-07	102	136	1	35	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
225843	COG3306	1.87e-04	260	425	72	242	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
366794	Glyco_transf_25	0.001	100	140	1	42	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIC33784.1|GT0	1.07e-192	10	452	4	445
QRW16830.1|GT0	3.14e-42	73	418	64	402
QRW18944.1|GT0	7.16e-42	59	418	39	372
QRV76091.1|GT0	7.28e-40	94	422	69	381
QRW04999.1|GT0	7.28e-40	94	422	69	381

PDB Hits     

POW04354.1 has no PDB hit.

Swiss-Prot Hits     

POW04354.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000004

TMHMM  Annotations     

Start	End
20	39