CAZyme Information: POW04009.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW04009.1
• CAZy Family: GH152
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		54196.18	5.2679

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000117:59926-62287(-)

Full Sequence      

MKLMNSLLVLYLATLLYPATCQSLGGNVQLDGMLNPSRDRDPQPLIPTKASLWASQAVAT
GQPVTPRGSVSAVQQGLLIPTGLPTLTQREDQCRISENLSAHADKKKCDGKYHNPIAATI
SGPWGGLGTPRAFVRREGTQLKATSDTYRPVGPNIYWLGLDENEGRRVSYPSRRRVREAF
GIAAAMGANTVRSISLGIIIVFTTEVGHFNTFLLQLDVISEFLILWLKTVISLILSGKYT
FLKWEGINTTDADAESNFYRNEDVIDTFKAYIEVILTHINQYTGIAYRDDPTILAWETGN
ELGAFDLEEGAPPASWTSEIARHIKSIDSHHLVIDGSDGVYDSDNQDIEGLDVEEVDIIS
DHLYPPNNVTFWRDHGLATSANKVLLIGEYDWTGSNGGMTLSMFFNQVINTDNVGDIAWN
VMTHDDQCCKFITHDDGYSIYYPNGNASIMQKRLLRLVQHWYHLTGRSSPHVLPAVTCPQ
PEWLKEH

Enzyme Prediction     

No EC number prediction in POW04009.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	252	426	1e-35	0.6328125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	1.09e-06	227	365	81	209	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIC33781.1|GH5	1.48e-189	81	486	85	499
CDR37878.1|GH5	7.57e-106	127	484	224	591
CDR46545.1|GH5	6.33e-92	119	481	144	521
AIC85594.1|GH5	1.41e-86	108	481	157	547
CDR46534.1|GH5	1.43e-83	116	481	115	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	2.73e-19	237	390	129	308	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	8.34e-19	237	390	115	294	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
1RH9_A	1.17e-17	133	365	6	254	Chain A, endo-beta-mannanase [Solanum lycopersicum]
4QP0_A	1.38e-17	257	390	131	294	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
1UUQ_A	2.37e-11	243	367	161	288	Exo-mannosidase from Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0JKM9|MAN1_ORYSJ	9.56e-22	127	341	31	250	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
sp|Q0JJD4|MAN2_ORYSJ	2.92e-19	133	375	54	316	Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN2 PE=2 SV=2
sp|Q10B67|MAN4_ORYSJ	4.32e-19	123	440	12	378	Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN4 PE=2 SV=2
sp|Q0IQJ7|MAN8_ORYSJ	3.08e-18	133	397	1	301	Mannan endo-1,4-beta-mannosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN8 PE=2 SV=2
sp|Q5W6G0|MAN5_ORYSJ	3.84e-18	122	341	73	289	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999793	CS pos: 21-22. Pr: 0.9879

TMHMM  Annotations     

There is no transmembrane helices in POW04009.1.