CAZyme Information: POW03402.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW03402.1
• CAZy Family: GH131
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		32364.22	7.7653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000126:94379-95877(+)

Full Sequence      

MCRDQTQLEREREITKMTRLHFSLLLLALCSGLSDVLCSPAAPASRNETVTASRNVTAPA
SRNVTAPSRAAGNQSVSQCTPMSETFKSSRLPPSWIQLSTNPQAHKMIAGGVSLSADKKT
NDKLGDGSTLNSTYSFLYGKVSLTVAASDVPGAVVALVLFGTTTADEIDIEILGGDSTHW
QTNVFRPAPGETEPLYGVFGGVHGYANGGTTGGTHTYTVDWSPRGITWSVDGQPVRHLSP
EQTLHNGQQHYPSARSRIQLGLWDASSPEGTSDWAHGPVPWAKRQRKAVTASIKSITVEC
PY

Enzyme Prediction     

No EC number prediction in POW03402.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	124	279	1.5e-31	0.8793103448275862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.38e-33	110	300	24	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.57e-30	110	275	11	167	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	1.60e-15	110	281	38	202	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.42e-09	110	278	39	194	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	1.04e-05	102	283	16	188	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96434.1|GH16	4.45e-54	102	302	846	1054
CDS13191.1|GH16	2.10e-35	121	300	83	256
CDS10243.1|GH16	7.17e-32	102	300	71	265
QIW99574.1|CBM18|GH16_19	9.44e-25	127	300	120	292
CDS12756.1|GH16	1.29e-24	124	300	1	136

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	2.90e-22	123	299	55	222	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3O5S_A	2.59e-10	163	274	125	216	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
3D6E_A	2.99e-10	110	274	32	179	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1GBG_A	3.58e-10	163	274	101	192	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
1CPN_A	3.86e-09	163	274	43	134	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	6.98e-24	120	300	118	300	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q8J0P4|CRF1_ASPFU	8.79e-21	74	299	20	243	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|Q5AFA2|CRH11_CANAL	4.44e-18	109	298	67	239	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|Q05790|CRR1_YEAST	7.09e-18	109	302	165	354	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|P53301|CRH1_YEAST	1.06e-16	80	277	56	236	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.180174	0.819811	CS pos: 38-39. Pr: 0.6722

TMHMM  Annotations     

There is no transmembrane helices in POW03402.1.