CAZyme Information: POW03045.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW03045.1
• CAZy Family: GH131
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2211		245601.12	7.2681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000132:95754-105867(+)

Full Sequence      

TTKAIDCCSLMSANNSSQARRKRPSNGTNYFKMSPSGITSPILLFLFHYSLVIINASPLI
YSHNPLAASAHPREYILSPHFDINEERITRTYTFNVTETTAALDGFLRPVLAINGQVPGP
LIEANEGDQLEITVINHMKVGLTLHWHGLYQASAESFASTYPLILSHHQNLMADGINGPL
IIHSPRDPLKRHTDFDQEVVLVLADWYHNTSTDIVEHMLSEPGYFGTPAAPGPNSALING
IGEWNCSQATKSEQCKQINSPPEFTFEAGGKIRFRLINAGVHAMFFYSVDEHTLNVTEAD
GTGIYGPPALHRVWLHNGQRYSVVINTREEDAGRSFYLRATMDSDCWAWVPNDIQLTAFG
ILRLVDGGYNAKKVSHSRPVTQDWSDEILGDCVDLPTSSMVPILKQSVPTSVVGSGSFKA
GFGFQFINDTSEHVSRAEAVQLAQQVNSTSLLLTTNPRTEDLNETSDTSNYLRNDTGRTL
LAERIHPARGLSKAQSQPEYPQTAYNKRQVKVGQHNLPSGNRTNQLGITRTGGPPPTPAG
TIGKFFLNNISWTTYPYQPILHDLTPGGVGAVNDSNVANVIYPTAEWYDLYLANVDPAGS
HPYHLHALDMHIVAEGKGLPTPQNLANATYNTDNPLRRDTIVVPPASFIVVRLQADVPGA
WIVHCHIGWHISRLEAGGVLHWDLKSEIRHICDRSLILCEIPLQIEYKWLAWSYGSPPIE
CDFTAYSNLEEDMSSSTGGKPKKRAHIVRSGNAGNSSKSAAPTPPTEPGKDKPPPLFPPG
SKTPVQLLHERCRHNKWEKPSVDIKRSSGGFTAVVTLVKKDKKDASLRHTVRMEPRPPLD
RTTGEEAKHWAATYALFRFCNNMPLHRVLPPGPKDYWVNLEQEKRTAPAHRDWEFDPDPF
QAAVEVKKRQQVREQNIEQSTSTHEGGSRGEEKKSLPKCWSLAPEVKMDHVLRDRSEQII
RGLLARIQVPDSESTSQDAHPSIHSNPQLSPSESKKLSDELIKMGFRPGHVSSALDHLSK
IRNTSESATNDKTSQLARTLLKSFQGSSDRDALLQYLTVVVPEDDLPIRFRPTEKSTSFV
TAMSSGAGQGPNGQELEIRWMVERLNRLHGFPLEAISTTLNGPVGPRESVALETLARRLA
GSDVDSPMKHADIASQETPEIKELLQSRDQKRAMEKEALESIYGVDRYQIVPEKPETDFQ
ISIVAQPQAREDLWLRISFHPDSLYPTATSLISTACIPTFSIISSTVPSYLRLALLKKTI
EQFADPNNGWCSMLDVGEGGVIFEMVNYLEETWPLLAQEPPDVADVMYNFVVEKQSPQSA
STSSSSPSIKPRGTPKQQSRVLALRQIPETDHRLMKEQCALIANPAYKSVLKDRQSLPAW
SSRADFLKALSDPTTRVIVVAGETGSGKTTQLPQFILESECEAGRGSLVNIICTQPRRVS
AIGVATRVASERLENIDEKDGVVGYVIRGEKRSGRHTKLLFATSGVLLRRLATSDPDLLG
ISHLFVDEVHERSMEGDLLLLELREILKRNLKIKIVLMSATANQDLFVNYFGTATRINIP
GMTYPVKDFYLEDYLKRLEYTPVNSKSRPERDAKERKQAEELCKKFMAMGHKESESRFLA
SASKAVRYIDEHLIASIVLNILDGSTSEQGDGSLGVVLVFVSGVAEICSAIKAIENLCRK
RVECLPLHSQLSSAEQKRVFRPTHPSRMKVVVATNIAETSITIPDVRYVIDSGREKQMEL
DPEVGMSRLVEVNCSQAAAKQRRGRAGRTISGVAYKLFTRICEQQTMLVDTKPEILRTPL
EALFLQVKAIREKEDVPTYLQKALTPPLQSAVDRAIENLEVVGAFYDGSLTALGKHLAQL
PLDVRLGKLLILGSIFKVFEPTLTLAAMLSVNKPLFVTPFEKREESSQARLKFKVANSDL
LTNIKAFDEYVRIQRESGNGSAREFCETNYLSMSTIRDIISTRSDLLSQMQERGFVPRSY
GKNNLNRLALVTPNAGDHADELNLNQNSEKLNLVKSVFAAGLSQVVRIEVPETKYDQIAS
GTIEKDVDSKAVKFFDAKIGRVFLHPSSVLFKSAQELKATFLAYFSRSASGSDTNAKVFL
RDGTTVPLFGMLLLYGSGSIKLNHERRGLSIQTRSSEQDGRETNESSIKLRAPMRIGTLC
NQLRHLLDTLLFMVVDQPEKIVNHWQNDTDAQQVIECVINLIESDGVACAI

Enzyme Prediction     

No EC number prediction in POW03045.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	165	672	2.2e-50	0.7318435754189944

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224557	HrpA	1.09e-142	1344	2069	7	657	HrpA-like RNA helicase [Translation, ribosomal structure and biogenesis].
259950	CuRO_2_Diphenol_Ox	3.79e-91	199	365	1	164	The second cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Laccase is a multicopper oxidase (MCO) composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.
259971	CuRO_3_Diphenol_Ox	3.63e-75	533	680	2	153	The third cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multicopper oxidase (MCO) which catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 3 of 3-domain MCOs contains the Type 1 (T1) copper binding site and part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
182986	PRK11131	2.60e-71	1375	1958	71	589	ATP-dependent RNA helicase HrpA; Provisional
350675	DEXHc_RHA-like	2.77e-64	1396	1559	2	159	DEXH-box helicase domain of DEAD-like helicase RHA family proteins. The RNA helicase A (RHA) family includes RHA, also called DEAH-box helicase 9 (DHX9), DHX8, DHX15-16, DHX32-38, and many others. The RHA family belongs to the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV98945.1|AA1	4.62e-121	72	706	50	599
QRW13493.1|AA1	8.60e-119	72	706	50	599
QRV91744.1|AA1	1.15e-114	81	749	39	599
QRV76916.1|AA1	1.15e-114	81	749	39	599
QRW05810.1|AA1	1.81e-111	81	749	39	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UP2_A	6.76e-107	1351	2204	22	830	Crystal structure of the murine DHX36 helicase [Mus musculus],6UP3_A Crystal structure of the murine DHX36 helicase in complex with ANP [Mus musculus],6UP4_A Crystal structure of the murine DHX36 helicase in complex with ADP [Mus musculus]
5VHA_A	3.13e-106	1351	2204	34	842	DHX36 with an N-terminal truncation [Bos taurus],5VHC_D DHX36 with an N-terminal truncation bound to ADP-BeF3 [Bos taurus],5VHD_D DHX36 with an N-terminal truncation bound to ADP-AlF4 [Bos taurus]
5VHE_A	9.31e-106	1351	2204	97	905	DHX36 in complex with the c-Myc G-quadruplex [Bos taurus]
5N8R_A	6.62e-92	1348	2118	124	855	Crystal Structure of Drosophilia DHX36 helicase in complex with GAGCACTGC [Drosophila melanogaster],5N8R_B Crystal Structure of Drosophilia DHX36 helicase in complex with GAGCACTGC [Drosophila melanogaster],5N8S_A Crystal Structure of Drosophila DHX36 helicase in complex with polyT [Drosophila melanogaster],5N8S_B Crystal Structure of Drosophila DHX36 helicase in complex with polyT [Drosophila melanogaster],5N8U_A Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCT [Drosophila melanogaster],5N8U_B Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCT [Drosophila melanogaster],5N8Z_A Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCCTT [Drosophila melanogaster],5N8Z_B Crystal Structure of Drosophila DHX36 helicase in complex with CTCTCCCTT [Drosophila melanogaster],5N90_A Crystal Structure of Drosophila DHX36 helicase in complex with TTGTGGTGT [Drosophila melanogaster],5N90_B Crystal Structure of Drosophila DHX36 helicase in complex with TTGTGGTGT [Drosophila melanogaster],5N94_A Crystal Structure of Drosophila DHX36 helicase in complex with polyU [Drosophila melanogaster],5N94_B Crystal Structure of Drosophila DHX36 helicase in complex with polyU [Drosophila melanogaster],5N96_A Crystal Structure of Drosophila DHX36 helicase in complex with AGGGTTTTTT [Drosophila melanogaster],5N96_B Crystal Structure of Drosophila DHX36 helicase in complex with AGGGTTTTTT [Drosophila melanogaster],5N98_A Crystal Structure of Drosophila DHX36 helicase in complex with TAGGGTTTT [Drosophila melanogaster],5N98_B Crystal Structure of Drosophila DHX36 helicase in complex with TAGGGTTTT [Drosophila melanogaster],5N9A_A Crystal Structure of Drosophila DHX36 helicase in complex with GTTAGGGTT [Drosophila melanogaster],5N9A_B Crystal Structure of Drosophila DHX36 helicase in complex with GTTAGGGTT [Drosophila melanogaster],5N9D_A Crystal Structure of Drosophila DHX36 helicase in complex with GGGTTAGGGT [Drosophila melanogaster],5N9D_B Crystal Structure of Drosophila DHX36 helicase in complex with GGGTTAGGGT [Drosophila melanogaster],5N9E_A Crystal Structure of Drosophila DHX36 helicase in complex with TGGGGATTT [Drosophila melanogaster],5N9E_B Crystal Structure of Drosophila DHX36 helicase in complex with TGGGGATTT [Drosophila melanogaster],5N9F_A Crystal Structure of Drosophila DHX36 helicase in complex with ssDNA CpG_A [Drosophila melanogaster],5N9F_B Crystal Structure of Drosophila DHX36 helicase in complex with ssDNA CpG_A [Drosophila melanogaster]
5AOR_A	1.29e-77	1367	1975	374	976	Structure of MLE RNA ADP AlF4 complex [Drosophila melanogaster],5AOR_B Structure of MLE RNA ADP AlF4 complex [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C7L7|YUM14_USTMA	0.0	776	2208	89	1566	Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=UMAG_11114 PE=3 SV=1
sp|O94536|UCP12_SCHPO	2.19e-146	782	2207	66	1327	Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp12 PE=3 SV=1
sp|F4ILR7|DEXH1_ARATH	2.27e-119	1354	2204	205	992	DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
sp|Q06698|YL419_YEAST	3.89e-118	782	2205	61	1434	Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR419W PE=1 SV=1
sp|Q6P5D3|DHX57_MOUSE	4.53e-113	1363	2126	531	1321	Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus OX=10090 GN=Dhx57 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998739	0.001255

TMHMM  Annotations     

Start	End
30	52