CAZyme Information: POW01633.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW01633.1
• CAZy Family: GH10
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A2S4UWH5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		92964.15	8.2864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000228:34762-38225(-)

Full Sequence      

MQNPYYKSGHRSGLDSTVNSEFDDNLDKYRELKTESFLGYLNRGNPEGSGSPVPSLPGLS
ERILHPEANYSATAYYTRETSEALNQPISTPNPSHYHPQHSANGFHRDPLSDEYRRASPA
TPFADTPTRDTRALTPLIIDPPTAISRHSHYTVGSGLGDSSETEGLRYSGMSFGDQPLRS
RVNRNVKPSRRKRAIFIVCIVIVVCTCAIIGLVIGLITKNKGMNNDTDGVARLPRGDKLW
GVGGDTITTDKGNKFLYNNTLGGTWVGIPYNDTARPQGNQPALNERWDYSVNKIIGVNLG
GWLVIEPFIAPGLFDPYVQEQNPPSDEWELSLRLGNSMAKTIEAHYDSFIVEEDFAQIAS
AGLNWVRIPVGWWMIETMGSEPFLAGVSWKYFFRAIVWARKYGLRINLDLHAVPGSQNSW
NHSGRLGTTGFLSGAMGIANAQRTLNYIRTLTQFISQPEFKRVIPMFSILNEPDVTLMSS
KALVSWYYESYKLIREIGGIGEGNGPFIVIHDAFQGIGAGLDSHTYFAFTAQLSDVNATR
PCNAWAARSNQTMEGFDWRSTTVACKSKTLYQEYSGIGTFIDDKHNQPVCLPRSLVISRY
VNNVGWGQRYEGTWPNATRPDRRFPKVGSCDQWLDHRKWSDAQKKGFADTASASQDALIN
SFFWTWKIGNSRQDFPPNPMWNYKLGLEAGYIRPDARTSTGRCAALASEYQVPLTTYEWS
GTLASWQTGGAGAGNISQSQIDAVGPFPPATILGGAPNGQGSYNTQSLPQLAPTGSPLIL
KPWRRRLFNNADKAGFFAPINGCTYLDPWSGVDAPAPAACNSSSTQSKQQSTANTSPSPL
RT

Enzyme Prediction     

No EC number prediction in POW01633.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	345	519	2.6e-61	0.5478547854785478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	9.25e-30	293	529	17	245	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
381626	GH113_mannanase-like	0.006	346	423	16	96	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
395098	Cellulase	0.009	347	473	22	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR48540.1|GH5_9	2.02e-171	187	818	188	851
QRV89957.1|GH5_9	1.89e-152	237	820	212	790
QRV75265.1|GH5_9	2.66e-152	237	820	212	790
QRW15426.1|GH5_9	4.49e-147	241	821	165	727
QRW00897.1|GH5_9	4.49e-147	241	821	165	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	8.69e-54	284	684	5	376	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	1.60e-53	284	684	4	375	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
4M80_A	1.60e-53	284	684	4	375	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
2PC8_A	1.64e-53	284	684	5	376	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	2.25e-53	284	684	5	376	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WMP0|EXGD_ASPFU	6.31e-75	190	710	302	826	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	6.31e-75	190	710	302	826	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|A2QX52|EXGD_ASPNC	1.46e-73	248	703	372	816	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgD PE=3 SV=1
sp|Q0CHZ8|EXGD_ASPTN	4.31e-73	224	703	351	824	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|A1DMX4|EXGD_NEOFI	1.45e-72	248	710	375	827	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

Start	End
194	216