CAZyme Information: POW01059.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW01059.1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		45427.37	7.3753

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000166:85651-87693(+)

Full Sequence      

MKNFINHIAPKVPFHTRPKPPLPPRPTASQSAPPLSQEPVLGGTVYSIPPFPPSHCAYYH
LNTILYAFAKITPAGEVSLSDPWGDIEKPFEASLGTPEFDPGFKGNLGEIAIMKYRNTKL
RCQLSVGGAGGEITTSFQRIIKSEHAMRKFAHDCKELCRKYGFDGIDVDYEHPENSAEGR
GLLELLRHTRATLDQLGHELGRQERYILSVATSMGEWSATHLPLREMNEVLDRIYLMTYD
ASGSWDKTLNHHAPLHSHHGKGLSAASTIHFYHSRGVPLHKLILGVPMYSRSFITKTGIC
GHHYDRVCGASEEATSEGTHMYNTLPRPNATEYHDSNLGVAYSFDGREWCSYDSPTSMSW
KTQFVRERGLGGVFFWELAGGHVAAKPPHPRDLVPVAWEGLHGAVGGSY

Enzyme Prediction     

EC	3.2.1.14:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	58	385	1.9e-56	0.8513513513513513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	4.93e-78	60	380	25	321	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	4.23e-68	43	380	13	333	Glyco_18 domain.
395573	Glyco_hydro_18	3.88e-61	45	378	11	304	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	9.86e-61	64	378	31	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	1.64e-59	64	380	68	422	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYO43345.1|GH18	5.91e-63	51	380	40	355
AXA51221.1|GH18	1.64e-62	51	380	40	355
QQK40281.1|GH18	4.30e-61	52	402	45	362
EGX45698.1|GH18	3.01e-60	51	395	21	362
SHO76337.1|GH18	1.08e-59	51	394	37	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	6.59e-58	61	386	42	366	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1D2K_A	1.94e-48	64	403	32	365	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	5.29e-48	64	403	32	365	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	1.03e-47	64	403	32	365	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
1WNO_A	1.60e-46	61	377	31	347	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92222|CHIB_EMEND	1.75e-52	61	386	30	355	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
sp|G5EAZ3|CHIB1_EMENI	1.75e-52	61	386	30	355	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	2.14e-47	64	403	67	400	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	2.14e-47	64	403	67	400	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|C5P230|CHI1_COCP7	5.81e-47	64	403	67	400	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999386	0.000635

TMHMM  Annotations     

There is no transmembrane helices in POW01059.1.