CAZyme Information: POW00464.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW00464.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760		82762.21	6.8829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000178:142230-144777(+)

Full Sequence      

MDKLSDDRVVPRAGTADEEQQALAHSPPPPAHVRSESSSDLPQLYLEETSLLLNPTIDVH
SSNSSNLRPSTTTRNDTSFSRYPPESLHSEHPPKLIGSSDSPAQSINTRNYSEYQPNCDH
QPPNHHHPNQIPPSYLLQPAATPYQDLILDRTDQHTGSNTFGNPIHTNRPPSPPHHPLSF
ISTTPSSRPSYHSRAQNSLDNLLAPQTSHSYSYNAINSSNSNSNDQSGSPQAQPCRVLPL
LPNHSSPTQSPLSSPTIIETPIMPAQLHQQNSSQHPDNLSSFNILSQYSPPLLPPQQHHH
QHHAPYLYPEPTSLLNSLDELKSSPNQEHKPSYSDTQNSSYPKKFESPTDSASQQKGLAA
NKFSDPRRARNRKFLMIGYRRLAVITLAGLLLILAAVGIILFIHLKRSGHPPDLTGDSDG
DVVGQSGLGSARNASSSTGLEPFNATNSAFGPDNGLRGGVNGYDSLVVFGASYCDNAHAR
PANLHHSLKPAPYYKGRWTNGYVWNEYLSAIIGPGGRPTTLVNYAFGGATVDNGLNEAPV
PDLEQQVNAFLSDLSAQSAGAGPSNGKSLIAIWVGINSITKIWNAVLKQEVLARSQLDVQ
DITTKAQLGINATVDHIFEVVTNLIHTTAFKAAVPDLLLLPIPPAQLLLVNLRAAKGNLG
ALRTLAALNDLFNARFADKLNSFENSLATEQRVFTLDIPTIWHKFIEDPGSAKLTVVDQP
CLTKSGVCSSPDSYLFWDTLHPTTHVHQQLALLMATEIKR

Enzyme Prediction     

No EC number prediction in POW00464.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	466	751	2.4e-25	0.9812734082397003

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.44e-38	465	755	1	268	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	5.21e-13	463	751	29	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	1.35e-11	463	751	1	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238875	SGNH_plant_lipase_like	1.61e-10	468	743	5	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
185279	PRK15381	9.29e-06	466	530	145	207	type III secretion system effector.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
URD49815.1|CE0	1.05e-23	463	759	33	291
BDA67938.1|CE16	5.80e-21	464	751	34	277
UNU27358.1|CE0	4.79e-17	464	750	15	256
UNU22132.1|CE0	1.59e-16	464	750	15	256
UFP94834.1|CE0	5.50e-16	464	758	69	338

PDB Hits     

POW00464.1 has no PDB hit.

Swiss-Prot Hits     

POW00464.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
382	404