CAZyme Information: POW00435.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POW00435.1
• CAZy Family: CE4|CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
183	PKSM01000251|CGC1	19190.48	7.7938

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000251:35218-36025(+)

Full Sequence      

MFKTALLILIIGSSMIGTTIGYTLRFKNNCGFTVWPAVGKAPNGQPDPSVAYGARLDPGG
SSQFGVNDREIGIRSWGRTGCDGGGGNCATGACNGGLRCTDGGITSRVLLGEYGYQQFGN
VISWDLSRVDGRINIDTSINNGGNVKTCRQSNCPTNQAFASPNDFQAITTSPVGSTFDIT
FCP

Enzyme Prediction     

No EC number prediction in POW00435.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH152	28	167	7.8e-21	0.6388888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185756	TLP-P	2.51e-17	24	183	1	151	thaumatin and allergenic/antifungal thaumatin-like proteins: plant homologs. This subfamily is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii, allergenic/antifungal Thaumatin-like proteins (TLPs), and related plant proteins. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs in this subfamily include such proteins as zeamatin, found in high concentrations in cereal seeds, and osmotin, a salt-induced protein in osmotically stressed plants. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. IgE-binding epitopes of mountain Cedar (Juniperus ashei) allergen Jun a 3, which interact with pooled IgE from patients suffering allergenic response to this allergen, were mainly located on the helical domain II; the best-conserved IgE-binding epitope predicted for TLPs corresponds to this region. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.
185754	Thaumatin-like	2.26e-16	24	182	1	157	the sweet-tasting protein, thaumatin, and thaumatin-like proteins involved in host defense. This family is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii and thaumatin-like proteins (TLPs) involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs included in this family are such proteins as zeamatin, found in high concentrations in cereal seeds; osmotin, a salt-induced protein in osmotically stressed plants; and PpAZ44, a propylene-induced TLP in abscission of young fruit. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.
128501	THN	5.54e-14	24	173	1	149	Thaumatin family. The thaumatin family gathers proteins related to plant pathogenesis. The thaumatin family includes very basic members with extracellular and vacuolar localization. Thaumatin itsel is a potent sweet-tasting protein. Several members of this family display significant in vitro activity of inhibiting hyphal growth or spore germination of various fungi probably by a membrane permeabilizing mechanism.
185757	TLP-PA	5.83e-13	23	156	1	133	allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. TLPs within this subfamily contain 16 conserved Cys residues.
395248	Thaumatin	3.40e-12	28	172	1	140	Thaumatin family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO97639.1|GH152	1.45e-63	3	183	2	178
QRG28800.1|GH152	5.89e-17	23	183	22	173
QLF99121.1|GH152	5.89e-17	23	183	22	173
QLF99123.1|GH152	5.89e-17	23	183	22	173
QLF99122.1|GH152	5.89e-17	23	183	22	173

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Z3Q_A	8.02e-13	23	153	2	121	Resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7A [Musa acuminata]
2I0W_A	3.30e-12	23	131	2	103	Chain A, Protein NP24 [Solanum lycopersicum]
4L2J_A	4.52e-12	23	167	3	139	Crystal Structure of Osmotin, an antifungal laticifer protein [Calotropis procera]
4BCT_A	5.83e-12	23	183	2	201	Crystal structure of kiwi-fruit allergen Act d 2 [Actinidia deliciosa]
1PCV_A	3.15e-11	23	131	2	103	Crystal structure of osmotin, a plant antifungal protein [Nicotiana tabacum],1PCV_B Crystal structure of osmotin, a plant antifungal protein [Nicotiana tabacum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50696|RST2_AVESA	1.76e-18	23	183	23	169	Thaumatin-like pathogenesis-related protein 2 OS=Avena sativa OX=4498 GN=RASTL-2 PE=2 SV=1
sp|P50695|RST1_AVESA	1.76e-18	23	183	23	169	Thaumatin-like pathogenesis-related protein 1 OS=Avena sativa OX=4498 GN=RASTL-1 PE=2 SV=1
sp|P50697|RST3_AVESA	4.86e-18	23	183	23	169	Thaumatin-like pathogenesis-related protein 3 OS=Avena sativa OX=4498 GN=RASTL-3 PE=2 SV=1
sp|P27357|TLP_WHEAT	1.05e-17	23	183	22	173	Thaumatin-like protein PWIR2 OS=Triticum aestivum OX=4565 PE=2 SV=1
sp|P32937|PR1A_HORVU	2.20e-16	23	183	22	173	Pathogenesis-related protein 1A/1B OS=Hordeum vulgare OX=4513 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000278	0.999703	CS pos: 21-22. Pr: 0.9757

TMHMM  Annotations     

Start	End
5	24