CAZyme Information: POV95411.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POV95411.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	PKSL01000346|CGC1	45179.64	9.8465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000346:148-2023(+)

Full Sequence      

PDACLKAAVHVALPQHFSIFSKLSISPNSPPPPELLPMLSVLRVQLALCLLASLSHALMP
NPQGFGTAAQRRPQGFGTAAQGQPQGFGTAAQGQPQAGFNPTAQRSPQGFGAAARQAQPG
SNFGMNGASGTGAQQAQPGSNLGTNGATGPPSLSNRIFDFQLTNNMRGTDLDNSSSALKR
LITYIVKGAASASQYVGIAPGRSAPELQVRIRDDSIFVPGGNAANAQNGFRRTDVLPAIN
KANAFNGITTWFQTIRLDSSAPLVLNHGYLLASIEIPVSDHVWDIFTGSDFDSQNTAHAA
SRNSQTIRVRDLRTNTLFSVPLQYNQAFNFAITTDWSANTLTVYASVGNQPLRKVAGPTP
NDPKLASSQAVQNGEYHLQLIKFPLPDANVPLAQRSDVPHFGFQEPIKQESVFFSNVFIT
SGGQH

Enzyme Prediction     

No EC number prediction in POV95411.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	158	422	1e-36	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.31e-56	157	419	2	245	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV95300.1|GH131	5.89e-41	157	421	22	296
ALL40783.1|GH131	8.22e-41	150	412	19	284
QRW09714.1|GH131	2.36e-38	157	421	22	296
QRV80910.1|GH131	6.39e-38	184	421	45	296
QRW22550.1|GH131	3.24e-36	157	421	22	294

PDB Hits     

POV95411.1 has no PDB hit.

Swiss-Prot Hits     

POV95411.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.806805	0.193182

TMHMM  Annotations     

There is no transmembrane helices in POV95411.1.