CAZyme Information: POV95392.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POV95392.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		70059.29	8.5540

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000347:29907-32557(+)

Full Sequence      

MWCISSKREQNSTDHVKAYTQALRNLCDCYEAGLGTSRGTNLASISLNLDDSQRLVMKCQ
GWALISVWLLISVQVALSRGVLQITRMGRYLYDANGKRFYIKGVAFRKPENIQNQGRGVP
GQAAGFSDPLGDINSCKHAIKDFKRLKINTIRVYNYNPEIDHSACMNALDKSGIYVIADI
KSPLSGSTNIASQHWDVDVLTQYINQIDSLRSFPNLLAFNIGDEFITSSEAVEAGPYIKA
RVRDVKLYLKSVNSTALASYASADGKKFPSELARFLSCHSGGPSAELDLFGLNNYRWCGD
SSFESAYQEIAPEFQGLAIAAYFSEFGCLTPGKPRSWNEIPTLFSTLMSDLWSGGVAYNY
YPTEQGYGLINEAQGKSVRNEDFDTLAQRYQQIKPPDMPKLTSLVSPKQKCSSTNANSFA
ITSVLPPQPNVEACNCVEQVTLSCQVRKNASPLVITELLDNLCKTLRASLPPGSGGGCGR
ISSSPSKGFYGSLSACSSSTRLSYAMTRHFINSGFDQKACNFSGNATVQNPIKVKSVEEL
YREASKCLEINANKVSPVRETRASQDTPAQINSAAYKQSLSGARSESRARSSACTLTPKR
KASIVDKTPACRSRMEECWIECVAGSYNYISFCDRLRG

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	82	393	2e-83	0.9807692307692307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.85e-76	89	393	18	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	2.98e-10	442	527	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	1.70e-04	442	530	1	75	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAW47197.1|CBM43|GH72	8.11e-109	76	548	15	488
AUB28916.1|CBM43|GH72	4.61e-108	84	548	24	489
AFR98731.2|CBM43|GH72	4.61e-108	84	548	24	489
UOH85570.1|CBM43|GH72	1.25e-107	84	548	23	488
ADV25841.1|CBM43|GH72	3.39e-107	84	548	23	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	2.40e-57	87	520	39	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	6.36e-57	87	520	39	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	6.36e-57	87	520	39	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C956|GEL4_ASPFU	6.55e-83	89	526	45	467	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	6.55e-83	89	526	45	467	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C955|GEL3_ASPFU	1.01e-78	89	531	22	454	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	1.09e-78	89	531	22	454	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|Q9P378|GAS1_SCHPO	2.88e-76	88	528	28	447	1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999014	0.000983

TMHMM  Annotations     

Start	End
61	83