CAZyme Information: POV95319.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POV95319.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	PKSM01000423|CGC1	55711.13	7.5625

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000423:6486-12548(+)

Full Sequence      

MLGLESNYSDTARFFLAWMDVGPAYFTNPDSPTRITSQSAGWEAQKYTHKSFQVPDRWAG
RFWGRRNCKFPNSGPGSCATGGCNGGLVCDHRTGSGVPPATLAEFKLNGDGGKDYYDVSN
VDGSNLPVRITNNKGCPTPSCGKDLNRDCPNDRLKVRDGNGATIGCLSACQMETTAIRQI
VALAVTTQRPLAQGQSSVLQLFQEGLRTLPILTLPPGSPVNPLLGSSRSHSTELRSSRSL
GRKVLGKRNCDFSKSGLLHAPTGGCNGGLVLMPKRVQATGDTCEFKLNGDGGQDFYDVSN
VDGSNLPVRITNNKGCPTPACPNDLNPGCPDDRLKVRDGNGVTIGCLSACQANLDGNHDN
SATACTGSHNHCAHLPERRVQFYDYFKNNCPDAYAYAYDESSQSALWTCNQPADYTVTFC
PKQEGIVYKVKTCAWDQVQTDSPDCPKDKPNLWCGSTADSSTISDCRLATFYNGCQDVGS
GRIGPEVKCCGSKVHPSGQYGNINCQTYAHQCSNFIY

Enzyme Prediction     

EC	3.2.1.39:2	3.2.1.39:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH152	34	175	2.2e-45	0.6574074074074074
GH152	230	421	8.1e-44	0.8564814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395248	Thaumatin	1.60e-58	23	170	9	149	Thaumatin family.
185758	TLP-F	2.62e-49	243	421	52	229	thaumatin-like proteins: basidiomycete homologs. This subfamily is represented by Lentinula edodes TLG1, a thaumatin-like protein (TLP), as well as, other basidiomycete homologs. In general, TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. TLG1 TLP is involved in lentinan degradation and fruiting body senescence. TLG1 expressed in Escherichia coli and Aspergillus oryzae exhibited beta-1,3-glucanase activity and demonstrated lentinan degrading activity. TLG1 is proposed to be involved in lentinan and cell wall degradation during senescence following harvest and spore diffusion. TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. TLG1 from Lentinula edodes contains the required acidic amino acids conserved in the appropriate positions to possess an electronegative cleft. TLPs within this subfamily contain 13 conserved Cys residues; the number of total Cys residues in these TLPs varies from 16 in L. edodes TLG1 to 18 in other basidiomycete homologs.
185757	TLP-PA	9.22e-46	21	171	12	159	allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. TLPs within this subfamily contain 16 conserved Cys residues.
185757	TLP-PA	3.47e-38	225	420	35	219	allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. TLPs within this subfamily contain 16 conserved Cys residues.
185754	Thaumatin-like	2.42e-36	20	141	10	126	the sweet-tasting protein, thaumatin, and thaumatin-like proteins involved in host defense. This family is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii and thaumatin-like proteins (TLPs) involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs included in this family are such proteins as zeamatin, found in high concentrations in cereal seeds; osmotin, a salt-induced protein in osmotically stressed plants; and PpAZ44, a propylene-induced TLP in abscission of young fruit. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). Thaumatin and TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. It has been proposed that the antifungal activity of plant PR5 proteins relies on the strong electronegative character of this cleft. Some TLPs hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Most TLPs contain 16 conserved Cys residues. A deletion within the third domain (domain II) of the Triticum aestivum thaumatin-like xylanase inhibitor is observed, thus, only 10 conserved Cys residues are present within this smaller TLP and similar homologs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANC28050.1|GH152	6.71e-59	21	421	30	254
QRW16658.1|GH152	2.39e-56	21	421	32	260
ALA44964.1|GH152	4.17e-56	21	421	32	256
BAE95855.1|GH152|3.2.1.39	2.55e-55	2	421	12	258
BAE95856.1|GH152|3.2.1.39	2.55e-55	2	421	12	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2AHN_A	4.11e-26	21	170	13	160	High resolution structure of a cherry allergen Pru av 2 [Prunus avium]
3ZS3_A	5.10e-25	41	170	30	160	High resolution structure of Mal d 2, the thaumatin like food allergen from apple [Malus domestica]
4L5H_A	3.08e-18	61	159	43	134	Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera],4L5H_B Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera],4MBT_A Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera],4MBT_B Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins [Vitis vinifera]
2D8O_A	5.09e-18	60	176	48	155	Structure of VIL-thaumatin [Thaumatococcus daniellii]
2BLR_A	1.25e-17	60	176	48	155	Thaumatin Before A High Dose X-Ray 'Burn' [Thaumatococcus daniellii],2BLU_A Thaumatin After A High Dose X-Ray 'Burn' [Thaumatococcus daniellii],2VHK_A Atomic resolution (0.94 A) structure of purified thaumatin I grown in sodium L-tartrate at 22C [Thaumatococcus daniellii],2WBZ_A 1.6 A Structure of Thaumatin Crystallized without Tartrate at 4 C [Thaumatococcus daniellii],3N02_A Thaumatic crystals grown in loops/micromounts [Thaumatococcus daniellii],3N03_A Thaumatin crystals grown from drops [Thaumatococcus daniellii],4AXU_A CRYSTAL STRUCTURE OF THAUMATIN FROM AN AUTO-HARVESTED CRYSTAL, control experiment [Thaumatococcus daniellii],5AMZ_A Crystal Structure of Thaumatin processed with the CrystalDirect automated mounting and cryo-cooling technology [Thaumatococcus daniellii],5AVG_A The 0.95 angstrom structure of thaumatin crystallized in high-strength agarose hydrogel [Thaumatococcus daniellii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P28493|PR5_ARATH	2.99e-28	41	175	52	183	Pathogenesis-related protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g75040 PE=1 SV=1
sp|P83335|TLP2_PRUPE	1.98e-26	21	170	36	180	Thaumatin-like protein 2 OS=Prunus persica OX=3760 PE=2 SV=1
sp|P50694|TLP_PRUAV	3.60e-25	21	170	36	183	Glucan endo-1,3-beta-glucosidase OS=Prunus avium OX=42229 PE=1 SV=1
sp|Q53MB8|TLPH_ORYSJ	3.85e-24	36	171	53	189	Thaumatin-like protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os11g0706600 PE=2 SV=1
sp|Q9FSG7|TP1A_MALDO	4.52e-24	41	170	54	184	Thaumatin-like protein 1a OS=Malus domestica OX=3750 GN=TL1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000001

TMHMM  Annotations     

There is no transmembrane helices in POV95319.1.