CAZyme Information: POV95192.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POV95192.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		68720.96	5.3888

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000358:11003-13739(-)

Full Sequence      

MSEVFDFIVVGGGQAGLTVASRLSENPKLKVLVLEAGGTGIGNDGIRIPGMIGGWQMNDS
TLTATDACDQTMTCSSGNTVTTLGSDIDWKYSTVPQEGANHREIYYPRGKVLGGSSAINF
IISTKAEVEDYEAIKRLGNPGWGWSEIDRASKKSERLAPPITDSDYIYNPDNHGTDGPVT
NSLPKYIPPQFRPYFAASAAASGVIQDKDAFCGKLGGACIIPSAIDTKGARVTSATAYYF
PNQSRPNLIVRVDCEVNKLILQETQINGEIQVLGVEYSSGGTVCRVMADEVIMSAGSIGT
PAILERSGIGKASILKSLNIPIALNLEGVGSNLSDHPALLATYRLKRGHRTVEDLSKDVE
YAAEQKLIYDKSGSGMFSHALSVLDFQSLKSIVSEEVLEDGLKLLEECPSYMSPKQFEAV
VNRIKNGVVVEYFLLNAFLVGDLYRFHTTFGDSSPKTLFITLHLNTEGIRWPSGQRHALY
PLSRGSSHIKSQDPSVAPLIDPQFVMHPFDAWLMVQGAKYARKIMRQDAYKDIIIDEQYP
GPSVQTDEEWEESIRSRISTSYHPSGTCSMLPQSESGVVDSQLKVYGTRNLRVVDASILP
IQLSGHPVMTVYAIAEKAAEMILNQGPSILSS

Enzyme Prediction     

No EC number prediction in POV95192.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	624	1.5e-163	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.05e-96	1	624	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.27e-90	1	627	2	536	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.32e-43	481	618	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.44e-27	99	338	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.73e-18	3	623	54	577	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SAM84677.1|AA3_2	5.61e-99	5	625	60	638
KIS68002.1|AA3_2	2.02e-98	2	625	56	635
CBQ68668.1|AA3_2	5.57e-98	2	625	56	635
SJX64303.1|AA3_2	5.57e-98	2	625	56	635
CDI54770.1|AA3_2	8.03e-98	2	625	56	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	4.64e-79	2	628	3	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	9.98e-72	5	622	6	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.08e-66	5	622	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.72e-66	5	622	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6YS2_AAA	2.03e-53	3	622	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	1.23e-82	1	627	10	621	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	1.84e-81	5	622	14	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.84e-81	5	622	14	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	3.54e-79	5	623	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.54e-79	5	623	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000001

TMHMM  Annotations     

There is no transmembrane helices in POV95192.1.