CAZyme Information: POV95133.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POV95133.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	PKSL01000363|CGC1	61589.21	8.6937

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93-210	15090	N/A	0	15090

• Gene Location: location=PKSL01000363:21331-24086(+)

Full Sequence      

MTFFSLNKGFIVSCFTLCFFCSVAFTSASGFQKIGLKQSPLAKSRQDEVKRVFASAFADY
MKFGYPYDEVRPVSKTGSNTRNGWSATLVDSLDTLFVMGLRDEFEKGILNTLKIDFTTSQ
TKDTVSLFETTIRYLGGMLSAYELSGSSNKPLLNQARTLGDKLLIAWPDSQQNLPFPTLD
FGRNMSVFGKDASTAEVLTAEAGTLILELERLSYHTRDPKYLRHAAKAMQAIMSTPSTFP
GLAGFSLAVKSQAVKNDKATWGAGFTCFLRSIATFSSYYEYLLKYGIISQNRDKSYLKTW
KLAVESSKQHLLQVSPLHNLTYLASFSSSKGGIDYEFSHLGCFAGGNWLLGGKVLNDPST
FEYGLRLIETCMETYKRTATGLGPESFRFLGPHDETAAKKPSSEVAFVTSYPQFTRLKNS
LRFFCIKQDLAFFKKNGFYIDSRSYILRPEVVESAFYAWRLTGDTRYQDFVWDAFQSLQK
HCKASAIFSAIADVNSLPAKFTDDSESFLYAELFKYFYLTFSDPNLLSLDEYVFTTEAHP
FRIMKGGV

Enzyme Prediction     

No EC number prediction in POV95133.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	53	543	2.2e-128	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.67e-167	52	543	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	7.74e-125	41	545	68	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBQ72197.1|GH47	2.24e-122	28	545	24	505
SJX62068.1|GH47	1.44e-120	28	545	24	505
AME15770.1|GH47	4.04e-120	28	543	24	502
CDS82437.1|GH47	4.04e-120	28	543	24	502
SAM81348.1|GH47	9.16e-118	26	545	18	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	2.08e-91	43	545	3	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	4.06e-91	43	546	38	511	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	3.93e-80	44	546	14	495	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	1.25e-68	43	545	20	469	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.56e-68	43	545	18	467	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	3.43e-95	38	543	32	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A1CP08|MNS1B_ASPCL	2.26e-93	38	543	28	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|D4AV26|MNS1B_ARTBC	5.95e-93	43	543	38	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q2ULB2|MNS1B_ASPOR	9.41e-92	22	543	19	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	9.41e-92	22	543	19	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.025946	0.974035	CS pos: 28-29. Pr: 0.9313

TMHMM  Annotations     

Start	End
9	31