CAZyme Information: POV95054.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POV95054.1
• CAZy Family: AA2
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A2S4UD18]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		80826.59	6.6925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000441:23470-26365(-)

Full Sequence      

MSVLQGSQVDGDLFAPVDSQRKHAAPPLPLFGQGCAHPQLPLHISGTVVTVLSGPINDPI
YPLPYAMAFLDGDSVLSPSRRQGFQAFDWTWHPTFHGIPKIFGPPVGQELILQSGIIQSR
YGFAVQFELSLPTNLSSKSRISFPTPEECANVGEEHHLYGFRKHRIGYSDGSIWLVYSLA
QQAGCTSHLNLQRLRPPIWVIQELGLVSSNLVKMSDHYGRQLEENSHRESEEFVYDHGIG
VWTHAATLRSGPMGSGQYSFDWITGGPRCNSVAPLMFALPHHTEALSDPTIVVKPEIRMQ
SRVTGVMRLCRAARWLFKENVADLRRYGIKPDYLPNGPPLYDALKIDLLRQVMVKEIDTD
FDAESDLDSYYFSGKKLAKQALQCLTASSILQDRDLAGKFVEKTKKSFDKFCRNRSKAAP
LVYENTWKGIISSSILRTGNRNDDFGNGVYNDHHFHYAYFIHTAAVLVYHDHSYLHSIRD
YVHDLIRDVNNSDQSDPYFPLFRNFDWFLGHSLATGLDTNIDGKNQESCSEDANVKVWAE
VTQNPRLGALADLQLSLFKRSVNHYYFMQEANTNAPACFKGNRVPGILFENKADYTTFFS
NEKDAIHMIQVIPITPITSFIRSPEFIWQEWINTGSPTENTRQVCQIATKLANGYQTLLL
TQYGIVDPNYVYNIFVKKLWMGQEIPLDDGLSLSWILGFLINQIELNKSEEKNGC

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	154	698	4.4e-119	0.7797427652733119

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.09e-138	346	697	7	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	5.04e-117	160	699	233	751	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.86e-18	37	320	1	308	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABH10633.1|GH81	1.54e-94	6	699	51	710
ATY59065.1|GH81	1.49e-90	41	699	330	1002
EAA66571.1|GH81	6.02e-88	31	704	253	894
CBF89420.1|GH81|3.2.1.39	1.02e-87	31	699	261	897
AAF13033.2|GH81|3.2.1.39	2.27e-87	43	699	88	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.53e-60	132	697	173	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.10e-60	132	697	198	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.87e-57	132	697	173	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.09e-21	325	702	301	655	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.30e-13	331	613	326	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	7.09e-87	16	697	14	696	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.10e-79	160	699	378	898	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.22e-78	257	699	338	774	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	9.97e-73	162	699	225	733	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.15e-69	122	699	548	1108	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996904	0.003138

TMHMM  Annotations     

There is no transmembrane helices in POV95054.1.