CAZyme Information: POV94967.1

Basic Information

• Species: Puccinia striiformis
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia striiformis
• CAZyme ID: POV94967.1
• CAZy Family: AA1|AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801		88507.62	8.6993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pstriiformis93TX-2	14629	N/A	0	14629

• Gene Location: location=PKSM01000447:20381-23147(+)

Full Sequence      

MNSNKQAKANPYQEEHPPQQAAKSSSTPAAAYLPSLSSSSPHQNQNQNQKPLSTDPQSKS
DPDSDSSDDSIIDQVRSQSELEHRALLISTGTLPAHSDPPHQSDHRIPAVLSSSLQSIIQ
SSNSPTSTTTTTTSSSSLHPAFDPPPSSTTVNRSTLTKTNYHLPSSSPPKYSISTTTTTT
PTTTTTTTSTLSSPPSYLPQSLFRPSIRRRSPTVHLITKPIISSSMDCPSYSHLQSSPSP
SSPDRLHHPSSCNPIISEKPSPVGRPSSYSFLVSSQSQPGSPNPGTTPSPKQRSWSDYLL
VLLVLVIVGTVVVLSTVNFYMGIFPSDVILPSELEVEPLRPSMVPKIIHQTWKTDQIPDR
WIPVRESCVAAHESYEYMLWTDKSGRELIEREYPWFLHIYDGYRYPIQRADAVRYFILHH
YGGVYMDLDIGCLRPMDSLLRFDLVLPQTVPVGVSNDLMFSAKGHPFMDFIIHRLGQFDH
DYQLNYATVMFSTGPMALSALYNMFRRSPSFGLTPGMPAFGPVRILPPKLYGKNLAAPQP
SPGPYFTHYYGSSWHTDGAGPVLWLGKFGIFWLYGGITVVMLFAVRAAIRHLLSKTPTSE
AQQTWSASSSPIKFRGSTGTLWKRRLLKVRRAEGRLADVLLLPGHWLEKATPRSLRAHHQ
KNCTQCKSCKAAEGLLDSANQLPLYEARSPQCPAPGRRPPRKSQRSDSGPEEEDWEEIDE
DTALLSATSTSDFMSTPTPVLLPSTPTFYRTSSALPTSGFLHYGSNENGQRSDIPTTFSS
SRTDETPFLTGNRPTPIRKAD

Enzyme Prediction     

No EC number prediction in POV94967.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	364	440	3.3e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.44e-49	343	573	81	299	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.74e-25	358	446	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDI52367.1|GT32	2.66e-93	293	581	7	338
SAM79788.1|GT32	1.18e-88	293	593	7	376
CDR87151.1|GT32	1.33e-88	293	581	7	366
CCA69953.1|GT32	1.40e-88	299	590	9	305
SJX61564.1|GT32	6.32e-88	293	595	7	382

PDB Hits     

POV94967.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.95e-62	342	590	55	293	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.77e-59	343	567	81	294	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.85e-58	327	578	37	286	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.48e-54	341	578	59	294	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.63e-51	327	567	54	274	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

Start	End
298	320
570	589