CAZyme Information: PNEJI1_003813-t26_1-p1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: PNEJI1_003813-t26_1-p1
• CAZy Family: GT66
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285		32736.31	9.6389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiSE8	3752	1209962	217	3535

• Gene Location: location=CAKM01000318:2356-3351(+)

Full Sequence      

MLGLALLSLTYFINDQLVLGCIFFVFSISFKQMSLYYSPLVFSYLLGLCIFPRLNVPRFF
LITGSTLFAFTLVFFPLLLSGGYPVLFQCLYRIFPFQRGLWEDKVANAWCVFNTLIKFKQ
KYSPSCLAKLSFAATAFSILPSCSILFLRPRKDLLPWGLLSCAFGFFLFSFQVHEKSILL
PLMPATMLLVTPNRNTKAWIGWINTFATFSMWPLLKRDGLLLQYAALLLYWLWLGGFVFH
PPGSLGTFETLIHMGSYTLLALIHLLEAFFSPPNRYPHLWVLLNM

Enzyme Prediction     

EC	2.4.1.267:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	1	284	1.4e-69	0.6632016632016632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	2.39e-73	1	285	148	461	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64400.1|GT57	3.44e-120	1	285	206	466
ANB14871.1|GT57	1.22e-83	1	285	404	696
CAA17695.1|GT57	3.82e-81	1	285	190	471
NP_596744.1|GT57	3.82e-81	1	285	190	471
BAP73742.1|GT57	1.46e-80	1	284	234	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	2.33e-72	1	284	221	532	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43053|ALG6_SCHPO	6.79e-82	1	285	190	471	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg6 PE=3 SV=1
sp|Q12001|ALG6_YEAST	8.03e-72	1	284	203	514	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG6 PE=1 SV=1
sp|Q802T2|ALG6_CHICK	9.92e-39	2	280	171	470	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus OX=9031 GN=ALG6 PE=2 SV=1
sp|Q9FF17|ALG6_ARATH	9.66e-38	2	285	210	498	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=At5g38460 PE=2 SV=1
sp|Q54QG6|ALG6_DICDI	7.92e-37	2	235	183	417	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg6 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000000

TMHMM  Annotations     

Start	End
4	26
33	55
65	87
154	173
198	215
220	239
249	271