CAZyme Information: PNEJI1_003313-t26_1-p1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: PNEJI1_003313-t26_1-p1
• CAZy Family: GT50
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	CAKM01000338|CGC1	55925.07	10.1595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiSE8	3752	1209962	217	3535

• Gene Location: location=CAKM01000338:10422-12192(+)

Full Sequence      

MKFLIFWGLYIPLLLIRFGFSVSESYIHPDEYLQGIQVVAGDILKIKVEYPWEFKGPFPI
RSIGPLWMIYGLPVKLAQWITGKGCSMEPLLLFFLLRIFFFGLSFIVDWFVYTSTSPKYR
GNALLLYASSFVTYTYQTHTFSNSIETIMVSACLLLMRKNKMSMSSWKCVLLAIFASIGF
FSRITFPIILIPFGFLFIKSLVKRPKMTFLTIKSFIIVFFILILVDSLYYANGRRIVLTI
LNNFNYNINYANLQKHGIHAYWTHFLINIPVMLGPAIFLPVIIKKIKFDIYLISSIIYIT
VLSLFPHQEFRFLLPVFPLLIVYLCSLGSIKGRKKKRLFMFSWIIYNILVGLFFVNQLST
NIIFWKTYPPPTWLFLRHSDSNIVFTHLIGYSVDHVLEYLSAAKKNKIIFIFPISSMAKF
SCVFDELKDSFCKTNITLRQIFKTSYHINLDDLDFMNNNIFSLLLHLVRKRGLGIWDVI

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	10	355	1.5e-58	0.8766066838046273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	2.29e-38	9	354	2	362	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	6.09e-05	24	323	57	353	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL66497.1|GT22	3.47e-160	12	479	149	518
UJO18587.1|GT22	4.56e-83	9	477	5	497
ATY60246.1|GT22	1.27e-82	10	478	6	511
QPH02021.1|GT22	4.06e-81	10	478	6	511
UPK89852.1|GT22	1.59e-80	10	478	6	511

PDB Hits     

PNEJI1_003313-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	6.52e-79	10	478	6	511	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	1.03e-76	10	476	6	535	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	3.27e-75	10	476	6	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	2.31e-70	10	476	6	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q09837|SMP3_SCHPO	2.55e-61	9	476	10	510	GPI mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smp3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.389965	0.610020	CS pos: 24-25. Pr: 0.3168

TMHMM  Annotations     

Start	End
4	21
90	112
174	196
209	231
261	283
290	307
312	330
343	365