CAZyme Information: PNEJI1_003181-t26_1-p1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: PNEJI1_003181-t26_1-p1
• CAZy Family: GT48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		88118.96	9.5659

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiSE8	3752	1209962	217	3535

• Gene Location: location=CAKM01000078:11183-13936(-)

Full Sequence      

MELISRNREKKEATVQEITKDSEEIKEKYPKKSSNASKNILLLVIFILSILTRFYYIQHP
SEVVFDEVHFGKFLSLYLRGSYFFDVHPPFTKLLYAFFGWIIGYDGHFLFEKIGDSYIKN
NVPYVYLRCVPAFAGAMVVPLVFLIMKDSGHSLLSSTLAASLVLFDNAQVAQSRLILLDS
VFIFLMTSSIYCYIRFSNLNNRQFSASWWKWLFLTGLFLSCTISTKYVGLFTYITIGVMV
LIELWDILDIRKGYTMHYFTMHFLARALCLIFFPFMLYLLWFYIHFNVLSKTGPGDKFMS
SSFQETLEGNVLSTSSFQVNYYDKITIIHKETNAYLHSHEATYPLRYEDGRISSQGQQVT
GYKHNDSNNHWIIMPAYPSNKTLLGSPVLDNDYIRLKHVSTNTYLLTHDVASPKYPTNQE
FTTISENLKSRYNETIFQIKFEHHTNNSILKTKGGRFMLIHNLTRVAMWSDIDPLPDWGF
KQQEVNGNKKLKGQSNIWIVDEIVDFNDTSRVIKNSTLKSLSFFQKYIELQFSMLHHNSR
LKASHPYSSYPIEWPLLNRGISFWTNHSQAQQIYLLGNPIGWWFEISFVIIFVTVVISDQ
ILLRRGLFLIRESRKLFYTHTIFFFLFWIAHYFPFYLMGRKLFLHHYLPAHIASSLLTGS
TFQLLFEKNNRSIIFLYFFKKNENKTNMNLKNFNSPRKAKIMFILLISSLLGSFIFFSPL
TYGKPGLTSNQLYERKWSPNWDYAYLEDSYE

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	44	286	1.4e-65	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	40	747	25	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	6.65e-70	44	290	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	9.49e-66	525	737	1	196	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	9.60e-16	337	492	13	179	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	2.11e-11	319	376	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64374.1|GT39	0.0	1	741	1	755
VBB72720.1|GT39	3.78e-251	30	737	41	763
CDP23606.1|GT39	3.91e-251	30	737	42	764
CAP69590.1|GT39	3.91e-251	30	737	42	764
EAA64589.1|GT39	1.57e-250	32	737	37	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.57e-87	38	743	49	729	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	2.58e-81	20	744	43	754	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	3.63e-09	336	485	25	173	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	4.83e-09	336	485	42	190	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]
1T9F_A	1.92e-08	319	457	7	150	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	6.01e-228	32	749	51	778	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q59X23|PMT4_CANAL	2.54e-207	42	737	51	746	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	1.80e-206	44	737	58	753	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1QF89|POMT1_DANRE	9.73e-108	39	742	15	714	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q29IL2|POMT2_DROPS	4.56e-104	32	743	27	749	Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=tw PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000015

TMHMM  Annotations     

Start	End
40	57
82	104
124	146
175	197
204	223
228	250
263	285
581	603
616	638
648	666
701	723