CAZyme Information: PNEJI1_002128-t26_1-p1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: PNEJI1_002128-t26_1-p1
• CAZy Family: GT33
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	CAKM01000164|CGC1	75038.96	5.9041

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiSE8	3752	1209962	217	3535

• Gene Location: location=CAKM01000164:3499-6075(+)

Full Sequence      

RFHPRRGESSLFASISWLSKETDWKTKLVGWTGEITLDFPQEVSTGLNKGNTTNNTNAVA
LSAKDKENFLECFSKVYTEEIIPIWMLLDSKDARSGETIEQQSRWRKYPNTERKEILMGM
LGANMIGFQSYSFSRHFVSTCTRVLGFDSIGKGIDVNGAYVAIEVLPMGIDAQYVEKESQ
AQKTQEKMQFIRELYSNKKILIGSAKIYEVQGVLQGLKAFESFLKQFSKWRNQVVFIQVT
SPVNDDTSKFEKQVQDLVAEINGTYGSLEFTPVHHYHQYLEKDEYFALLRSGDVGIITAI
RDSINTTSLEYVICQKESNGPLLLSEFSGTKDALQDAIQVNPWDVTDTAKKINEALCISE
SEKKTRQIKLYNYVTKNTIQTWTSSFISRLLTNLATFNYNQVTPVIDTTLLIDTYRKANN
RLFLFDYDGTLTPIVKDPLIAVPSRRLIHVLQALAENSKNQVWIISGRDQNFLAQWFDNI
PQLGLSAEHGCFMRFPNTFDWVDLTENMDLSWQEEVYKIFEYYTERTQGSFIEQKRCTLT
WHYRRADPDYGLFQALECQNHLESLITSNYDVEVLNGKANIEVRPFFINKGRVANQLLNM
YKDEKPDFVFSAGDDKTDEGDMFRVLKQRHDLKDKAYFTVTIGASNKVSASSVL

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	105	390	6.9e-93	0.6042105263157894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	4.61e-151	112	646	179	703	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	7.15e-109	112	390	180	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215556	PLN03064	7.30e-107	113	613	278	797	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	1.21e-102	108	613	182	707	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	2.71e-99	113	390	185	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64466.1|GT20	0.0	1	651	75	806
EGX46320.1|GT20	3.01e-221	5	652	66	825
UJO21636.1|GT20	2.76e-214	3	647	142	902
QRD94182.1|GT20	9.32e-212	4	652	79	854
BAE63282.1|GT20	9.32e-212	4	652	79	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	1.67e-94	403	652	3	253	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	2.84e-92	403	652	3	253	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	2.13e-80	6	393	63	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	7.02e-79	400	628	2	246	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5DX9_A	2.49e-70	403	627	3	224	Chain A, trehalose-6-phosphate phosphatase [Cryptococcus neoformans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	1.07e-171	5	649	64	793	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|P31688|TPS2_YEAST	3.11e-156	113	647	245	825	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	2.25e-146	113	637	251	810	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	3.42e-134	111	626	262	777	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54K57|TPSA_DICDI	1.62e-115	113	639	192	722	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PNEJI1_002128-t26_1-p1.