CAZyme Information: PNEJI1_002026-t26_1-p1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: PNEJI1_002026-t26_1-p1
• CAZy Family: GT24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	CAKM01000196|CGC1	67274.38	5.4279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiSE8	3752	1209962	217	3535

• Gene Location: location=CAKM01000196:18412-20481(+)

Full Sequence      

MTRVFEKNNLDWNIFFVKTCFCCLFSRKFLKTFVWIGLLIKSNAYPLSTVRGGDRNIHNG
GSSNNGNSPKGCRFPFENPELAAVTSDGNIFGWALGAGPTCLPGSHCTYFCRSGYFAQPS
SKVDFSSVFMLEQEGRVFCDESGNLQIPSGSLCVAAPQNIYVLNLFDTSASYCQESFSNG
IFQLASNYVPGHSFSTIAVPSHVGSRSSSYYFNPPGSGNDLCTIGSRFSNQGAWSPYTLE
LSSDYKGDLYLRLGWNPRYTHDSYWKGVSPNWGIRLDCEGPSCDHSPCFIDPSIHNVNEC
ENAQHGYSDAVFCGIKLSARSRARVVLFSKDNVNDEQRFLSALPRFDFEDASDDTSLTEK
AHVPESQHEEYKSTVDDTKVSEHHESHEEKTKDEQKSEDKQGSEKSEHTNDKIDNSEHSQ
TSKSDNPENKKSTFIDSLSKIDFSSITNLEQSSSGSDFNKYISKSSDITLMLFHLEGSKN
QHMHASGLSCPLSNHDNANSLSANSPDSVLDDCGPTHGLLFLSKPVNSGYKLLADKFENY
MSRISLLIRDGNFQTLEFDIPKNTEESSPANNGTNHENSAYIMRNNILWTLITVLGIIIF
LIDIN

Enzyme Prediction     

No EC number prediction in PNEJI1_002026-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	72	319	1.4e-24	0.801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	5.50e-27	92	291	25	230	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65200.1|GH132	1.60e-39	101	339	62	297
CAR28817.1|GH132	1.62e-38	31	334	6	305
QLG73566.1|GH132	4.36e-38	36	329	11	305
QFZ39256.1|GH132	1.23e-37	72	329	23	282
QFZ27107.1|GH132	1.23e-37	72	329	23	282

PDB Hits     

PNEJI1_002026-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74851|ADG3_SCHPO	4.17e-33	72	327	73	333	Probable secreted beta-glucosidase adg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adg3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.967509	0.032498

TMHMM  Annotations     

Start	End
580	602