CAZyme Information: PNEJI1_001837-t26_1-p1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: PNEJI1_001837-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744	CAKM01000184|CGC1	85087.13	6.3611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiSE8	3752	1209962	217	3535

• Gene Location: location=CAKM01000184:34126-37317(-)

Full Sequence      

MGRTLDNSMLNLGIKDIIKIGIDELGFNIEDIIDAETDAALGNGGLGRLAACFLDSLSSL
NMPAWGYGLRYQYVGIFKQQIVDGHQVEQPDYWLQFENPWEMLRQDVRIPVRFYGHVRKY
ADNDGKTRYSWQGGEQVLAVASDVPIPGYGTNNTNNLRLWSSRPMREFDFSKFNAGDYEN
SVREQQRAETLSAVLYPNENVYQGKELRLKQQYFWVCASLHDIVRRFKKSGKPWSKFPEQ
VSIQLNDTHPALAVVELQRIFVDLEGLEWDQAWNIVVKTFGYTNHTVLPEALEKWPIPMF
QELLPRHMQIIYDINLFFLQSVEKKFPKDRELLSRVSIVEESSPKYVRMAYLAIIGSSKV
NGVAELHSNLLKTTIFKDFVKIYGPDKFVNVTNGVTPRRWLLQANPKLSELISRKLGGYE
FLTNLSKLKELENFANDKEFQKEWKQVKFYNKARLASYIQRTKGLKLNINALFDIQVKRI
HEYKRQTLNIYGVIHRYLTLKSMSKGEIEKQVPRVSIFGGKAAPGYYMAKCVIKLINCVA
DVVNNDKSIGDVFKVHFIEDYNVSKAEIIIPASDISEHISTAGTEGSGTSNMKFVLNGGL
IIGTVDGSNIEITREIGEENIFLFGNLSENVEELRHRHIYGNVPMDPELKKVCDAIESGI
FGDPNLFAPLMSALTNGHDYYLISDDFQSYLNTHKIIDETYKDSDLWVYKTIISVANMGF
FSSDRAIQEYAEGIWNIEACPLDE

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	22	738	4e-274	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	1	738	81	811	glycogen phosphorylase; Provisional
223136	GlgP	0.0	1	739	73	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	2	735	71	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	1	737	61	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	1	737	64	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX46445.1|GT35	0.0	1	743	133	874
APA13713.1|GT35	0.0	1	738	138	874
QSZ32738.1|GT35	0.0	1	744	138	880
BAE60752.1|GT35	0.0	1	738	74	810
QRD89946.1|GT35	0.0	1	738	137	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	1	738	108	876	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
3CEH_A	2.38e-255	1	738	69	806	Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FC0_A	4.09e-255	1	742	91	832	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1FA9_A	4.09e-255	1	742	91	832	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1EM6_A	4.23e-255	1	742	92	833	Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 [Homo sapiens],1EM6_B Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-526, 423 [Homo sapiens],1EXV_A Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-403, 700 [Homo sapiens],1EXV_B Human Liver Glycogen Phosphorylase A Complexed With Glcnac And Cp-403, 700 [Homo sapiens],1L5Q_A Human liver glycogen phosphorylase a complexed with caffeine, N-Acetyl-beta-D-glucopyranosylamine, and CP-403700 [Homo sapiens],1L5Q_B Human liver glycogen phosphorylase a complexed with caffeine, N-Acetyl-beta-D-glucopyranosylamine, and CP-403700 [Homo sapiens],1L5R_A Human liver glycogen phosphorylase a complexed with riboflavin, N-Acetyl-beta-D-Glucopyranosylamine and CP-403,700 [Homo sapiens],1L5R_B Human liver glycogen phosphorylase a complexed with riboflavin, N-Acetyl-beta-D-Glucopyranosylamine and CP-403,700 [Homo sapiens],1L5S_A Human liver glycogen phosphorylase complexed with uric acid, N-Acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L5S_B Human liver glycogen phosphorylase complexed with uric acid, N-Acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L7X_A Human liver glycogen phosphorylase b complexed with caffeine, N-acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens],1L7X_B Human liver glycogen phosphorylase b complexed with caffeine, N-acetyl-beta-D-glucopyranosylamine, and CP-403,700 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	1	738	131	899	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	5.76e-292	1	743	108	846	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	1.32e-281	1	738	178	908	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|O84250|PHSG_CHLTR	4.83e-258	1	737	77	809	Glycogen phosphorylase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=glgP PE=3 SV=1
sp|P73511|PHSG_SYNY3	2.21e-257	1	743	93	832	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999962	0.000063

TMHMM  Annotations     

There is no transmembrane helices in PNEJI1_001837-t26_1-p1.