CAZyme Information: PNEJI1_000148-t26_1-p1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: PNEJI1_000148-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	CAKM01000279|CGC1	45297.66	9.6022

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiSE8	3752	1209962	217	3535

• Gene Location: location=CAKM01000279:58828-60464(+)

Full Sequence      

MTQKMKKSIYDTIYFYIHMVLNSTYGIFIIGGLLRTFFLIYGHWHDSRSPVKYTDVDYKV
FTGAAEQAYYGKSVYDRETYRYTPLLAWMLIPNVMGVPCFGKIIFSISDLIAGYLIKNIL
VFQGYCIKKANLYTIIWLWNPIVAVISTRGNAESIVGTGVLLCLWMAFLKRSFLTGFLLG
VVIHFKLYAIIYIPTFLWIMDSKYEGKSLSKTNFNWVTYSPSVILNGIMYQIYGMPFLNH
TYFYHLIRIDHRHNFSPYHLWLYYVSSPIKSSFHIPISFVSFIPQVLLSTCLIPIALAKK
NLSGSIFSQTFAFVTFNKVCTSQYFMWYIVLLPILLPSLDLFLGLIMLILWVFGQAIWLF
FAYRLEFLGINEFNLNFNARYFINNFIN

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	146	375	1.2e-70	0.9198473282442748

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	7.97e-71	27	373	11	393	GPI mannosyltransferase
252941	Mannosyl_trans	1.52e-54	146	373	1	237	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64979.1|GT50	5.69e-159	56	373	23	350
UKZ75326.1|GT50	9.34e-109	27	373	15	360
UKZ48798.1|GT50	1.94e-107	27	373	15	379
UKZ90890.1|GT50	1.10e-106	27	373	15	379
QYS97269.1|GT50	2.67e-100	27	373	15	406

PDB Hits     

PNEJI1_000148-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	2.04e-97	24	373	10	382	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	7.42e-96	33	373	17	384	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	2.17e-93	28	373	9	402	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.71e-91	33	373	35	459	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	4.54e-91	34	373	18	395	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000033

TMHMM  Annotations     

Start	End
12	34
94	116
136	168
178	200
213	235
275	297
304	326
341	363