CAZyme Information: PMAA_102150-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_102150-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
919	DS995902|CGC32	103401.83	6.3031

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:3262041-3265211(+)

Full Sequence      

MSSRFPSRWSFRGSKTPKDGGTPDETTSQRGSLPVSESGRSSRGQSYFDKRYANNIDDAS
KYKAMTKFFHVRLTAYQWLPSPTHSPHGSTGVFLRRSRGVYMSEPEDVNPMLLAAIQRIN
AVVAFTMKTETTSIITSQLAPGQTELILPNGYQVQIIESYADIVGSHSNMVKKYQYSALI
REEQLLLVWNDDLNAILSHGADIEAKLLSLIWGSPVPTFNLQAIPMMTPAESVMASPNDS
LYHLAIESRDSQPAAEDSGVSRDASPRRMIYEEVKRPKESLERPLAVTSAIFVGMAGMLL
VILLLGFGISNLLLEYSVDGGAMRFALTATIPFFLLFSIFFMIVIFTDIFQAIGPVKTLK
SNSRFYSPIAPDLKSAYSLGFTPPRVTIQMPIYTESLEGVIKPTISSLKTAISHYESHGG
TANIFINDDGFALLSEEEKRERINFYHDNNIGWVARPRNNEDGYVRKGKFKKASNMNFAL
NVSNKVEAELIQRMSPTLEKSDLVDPMEEELVYREVFNHVIQSDPRIRGAGGDIRVGEFI
LIVDSDTRIPADCLLYGAAEMFLNPEVAIIQHSTSVMQVSQDYFENGITYFTNLIYSAIR
FAVGSGETAPFVGHNAFLRWQAVQSVGRPDDGYVSFWSESHVSEDFDIALRLQIQGNIIR
LASYHNDEFKEGVSLTIYDELSRWEKYAYGCNELVFNPVHTWFYRGPLTKLFMTFLWSNL
QLSSKITILGYISSYYALASGFPLTVLNYFLVGWFEGYLDKFYMESWKVFLSLLVVFSAA
GNICLAIIRYRLGEKPLLSSLVENFMWMPMFAIFFGGLSFHLSLAILAHMFGINMSWGTT
AKEKDDSNFFIEMPKIFKSFKWMYAVVLPFFPGMIYLACFAPHGWTITEVGAIVPMSVTL
ASHALLPLLLNPSLMVFNY

Enzyme Prediction     

No EC number prediction in PMAA_102150-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	540	751	1.3e-55	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.15e-52	539	752	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	5.66e-11	537	843	138	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.20e-10	388	645	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133043	CESA_CelA_like	1.86e-04	384	656	1	197	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224137	GT2	2.35e-04	509	731	47	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18667.1|GT0	0.0	1	919	1	919
CAE7220538.1|GT0	0.0	56	919	53	907
CBX97842.1|GT0	0.0	56	919	53	904
QRD03074.1|GT0	0.0	56	919	3	858
UNI18966.1|GT0	0.0	32	919	25	905

PDB Hits     

PMAA_102150-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PMAA_102150-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

Start	End
291	313
325	347
733	755
768	790
805	827
865	887
892	914