CAZyme Information: PMAA_101900-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_101900-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471		50054.08	4.3701

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:3198430-3199914(+)

Full Sequence      

MAARLSICLLAALGFNQSAVVTPLSPNYNSSLSIYNLNIPILPAAVTYPSTTKQVAGIVR
CAAEGHYKVQAKGGGHSYGNYGWGGESGEVVINLANLNGYSYDNSTGYATVGAGSRLGPV
TTALYNSGERAFAHGSCPDVGIGGHATIGGVGPTSRRWGATIDHVVSATVVLADGSIVTV
SETENPDLFWALRGAGGSFFVVTEFVLRTEAAPAGGVSYAYAFRGLNATAQAQVFRDFQA
FISNSSLSRDLYIMMIGLPSVIEVTGSFFGSLEDFNALGLEQAFAIAPVANVTVIPNWLD
MVGIWATQSASAERPAYFYAKSLDVLPDALLSNDTIDSMFKYLTTTPDDALIYELEVQLV
SGAMADVASSATSFPHRDVLYWIFAYAATNGTVSNTTIDFLDGINDVIYSASPNQTFHAY
AGYVDPLLSNGPELYWADNLPRLEQIKKQYDQFDVFHNPQSVPVGGDSCGL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	34	397	1.3e-77	0.777292576419214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	2.65e-34	40	463	29	457	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	2.92e-30	43	181	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	4.11e-11	419	463	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	3.90e-10	49	208	21	177	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.
215242	PLN02441	4.75e-10	42	213	64	242	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17347.1|AA7	2.30e-137	8	464	12	473
QMW42271.1|AA7	1.49e-135	8	462	12	471
QMW30198.1|AA7	4.22e-135	8	462	12	471
QRD86662.1|AA7	5.65e-135	8	462	21	480
UDD61931.1|AA7	1.36e-133	8	462	12	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	6.39e-70	25	462	43	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	2.88e-68	23	462	17	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6Y0R_AAA	3.27e-68	25	462	43	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
1ZR6_A	3.58e-65	25	462	25	476	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	7.37e-64	25	462	25	476	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	2.28e-120	2	463	4	468	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	3.29e-69	25	462	43	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	1.68e-67	25	462	43	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	2.53e-67	23	462	39	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	1.68e-64	25	462	44	495	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000313	0.999675	CS pos: 18-19. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in PMAA_101900-t26_1-p1.