CAZyme Information: PMAA_101190-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_101190-t26_1-p1
• CAZy Family: GT35
• CAZyme Description: pectate lyase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	DS995902|CGC5	33477.80	6.2667

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:2986100-2987277(+)

Full Sequence      

MKAIITALALISSYTLAAPAEQLVKRASASDSATGYASLNGGTTGGASGTTTTVSSYAAL
ATAVTGNDKKVIFVSGTITQTADQIRPGNNTSIIGKNSSAKLVNFGILVKEASNVIIRNL
GICKVLANNGDAIGVQYSNNVWIDHVDVSSDRDHDKDYYDGLIDLTHAADFITVSNSYIH
DHWKPSLIGHSDSNGAQDTGHLHVTQNNNYWHNNSRTPSIRFGTGHIYNSYFDQVNDGVN
THDGAQVLVQSNIFVNSSQPLYSTDDGYAVATDNDFGGASNKAEAGTLKSVPYSYSLLGS
MNVKASIVGTAGQTLSF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	74	254	8.8e-82	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.67e-54	78	258	5	190	Amb_all domain.
226384	PelB	9.55e-45	54	312	59	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.38e-33	83	254	28	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18761.1|PL1_7	7.53e-212	1	317	1	317
ADK25712.1|PL1_7|4.2.2.2	1.08e-180	27	317	2	293
BCR87486.1|PL1_7	1.28e-149	11	317	15	324
CAP99777.1|PL1_7	9.94e-147	5	317	9	324
CAK40523.1|PL1_7|4.2.2.2	1.36e-146	2	317	5	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	5.51e-38	35	312	6	321	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.13e-28	34	232	9	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1OOC_A	3.30e-28	20	232	1	257	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	6.13e-27	20	232	1	257	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]
1VBL_A	1.06e-24	88	233	131	302	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QV36|PLYA_ASPNC	2.42e-147	2	317	5	323	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	1.98e-146	2	317	5	323	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|B0XT32|PLYA_ASPFC	5.78e-143	1	317	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|Q4WIT0|PLYA_ASPFU	1.16e-142	1	317	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|A1CYB8|PLYA_NEOFI	1.91e-141	1	317	1	321	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999734	CS pos: 26-27. Pr: 0.9399

TMHMM  Annotations     

There is no transmembrane helices in PMAA_101190-t26_1-p1.