CAZyme Information: PMAA_100200-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_100200-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: integral membrane protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	DS995902|CGC30	43557.63	9.2712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:2719539-2720783(-)

Full Sequence      

MWSAHTFSFCFLVVSSRALAQFQTFSPPGQSDVTYSINVPEHTSTTGSGPIFLQIKSTVA
VEWVAFGEGTRMQGSNIFVVYGNGNGNATVSPRLGGPHVEPLYNPQAQVSLLDGSGVSDN
GSITANIRCDSCITWSGGGHEDVTSASASWVWAIKYGKLIQSDSVSATIRQHDVAGLASV
NLKAATGGNLDNPFLASASPTSSTASTSSFSPSSSSSSSSTQPVVVTTVGSQSTDRERIA
HAVVMITVMVVLFPSFALGIHLFPSSHTVVLHAWLQLSTLALAIIGFALGISLSVDLYPV
TGSSYHQIIGIIVISSLILFQPAMGLLQHRYWRKSGQKGTFAYLHRWLGRTMIALGIVNA
GLGFWFTGIGSSMAPNGAVVAYGVVAGVVGIGYVLMLAFLARRARHARPTNVAS

Enzyme Prediction     

No EC number prediction in PMAA_100200-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	21	186	3.9e-19	0.9120879120879121

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187688	CDH_like_cytochrome	3.47e-50	13	182	2	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
406418	CDH-cyt	1.40e-30	22	186	10	174	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
176490	Cyt_b561_FRRS1_like	1.35e-26	228	372	26	168	Eukaryotic cytochrome b(561), including the FRRS1 gene product. Cytochrome b(561), as found in eukaryotes, similar to and including the human FRRS1 gene product (ferric-chelate reductase 1), also called SDR-2 (stromal cell-derived receptor 2). This family comprises a variety of domain architectures, many of which contain dopamine beta-monooxygenase (DOMON) domains. The protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
214769	B561	1.96e-10	241	364	2	129	Cytochrome b-561 / ferric reductase transmembrane domain. Cytochrome b-561 recycles ascorbate for the generation of norepinephrine by dopamine-beta-hydroxylase in the chromaffin vesicles of the adrenal gland. It is a transmembrane heme protein with the two heme groups being bound to conserved histidine residues. A cytochrome b-561 homologue, termed Dcytb, is an iron-regulated ferric reductase in the duodenal mucosa. Other homologues of these are also likely to be ferric reductases. SDR2 is proposed to be important in regulating the metabolism of iron in the onset of neurodegenerative disorders.
176496	Cyt_b561_ACYB-1_like	1.77e-05	233	364	1	136	Plant cytochrome b(561), including the carbon monoxide oxygenase ACYB-1. Cytochrome b(561), as found in plants, similar to the Arabidopsis thaliana ACYB-1 gene product, a cytochrome b561 isoform localized to the tonoplast. This protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), and might be capable of trans-membrane electron transport from intracellular ascorbate to extracellular ferric chelates. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR42136.1|AA0	1.53e-62	12	393	11	374
SMR44317.1|AA0	1.53e-62	12	393	11	374
CAE7013938.1|AA8	3.51e-60	12	394	12	374
SMR55355.1|AA0	4.80e-57	33	414	25	375
SMR57731.1|AA0	4.80e-57	33	414	25	375

PDB Hits     

PMAA_100200-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PMAA_100200-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999727	CS pos: 20-21. Pr: 0.9668

TMHMM  Annotations     

Start	End
242	264
271	293
308	327
347	369
379	401