CAZyme Information: PMAA_098730-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_098730-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	DS995902|CGC34	59278.33	8.1982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:2297928-2299529(+)

Full Sequence      

MEKQVDVEVNALQTPVESIRSSERRSNVQSGLKKVYQDVAWAFTTTSDGVQDWTPFVLVL
SYFVFSTTIYMNATSGINEVFWFIYLMTNTYIATATVIESISALGNFQDAKRAVDKVSKK
NWVFPTAENKLPKLDIIVVAYLPNEQDIVMDRLKYLLEEIVYPRDRYRVNLLYNTPYAIQ
PLESELFALADEYPKNMRVVKVPGSKSKADNINYYCNVIQTDADISAIFDCDHYPHPYAP
KWAMEQFAKDKELDIVQGRCVVLNATDNFLTSMIAIEFDKIYAVSHPGRSAMFHFGLFCG
SNGYWRTSLLRELKMDDSMLTEDIDSALRAFGHGAKAVHDINVTSFELAPVTFSAFWKQR
LRWSQGWIQASMRHVHLVWSRSREGKHRSMRQRFGIFSLLFVREISYYLITQYLCLVLSV
VITEFPKSGDDLYKLLFFQYPIAWWLFIFSLLALVGTLWVTFHFRSEFCRWYTIPIFAAT
YLPQLVLTAVIGLFGHARQVSKYVKWNPTPRN

Enzyme Prediction     

No EC number prediction in PMAA_098730-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	227	453	2.3e-18	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133045	CESA_like	4.42e-39	136	323	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	6.06e-28	127	480	49	378	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133059	CESA_CaSu_A2	1.25e-21	138	366	3	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133049	CESA_like_2	3.54e-20	157	374	23	240	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133043	CESA_CelA_like	1.96e-19	132	369	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18997.1|GT2	0.0	1	512	1	512
QKX64079.1|GT2	1.73e-284	19	511	31	524
CBX90388.1|GT2	1.49e-204	33	511	20	504
CAE7201725.1|GT2	8.67e-200	50	511	44	508
ATZ50909.1|GT2	6.21e-182	42	512	90	558

PDB Hits     

PMAA_098730-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P96587|YDAM_BACSU	1.32e-15	130	366	47	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
sp|Q84W54|CSLA1_ARATH	6.54e-09	224	427	216	417	Probable glucomannan 4-beta-mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CSLA1 PE=2 SV=1
sp|Q84W06|CSLAE_ARATH	1.48e-08	228	366	191	330	Probable glucomannan 4-beta-mannosyltransferase 14 OS=Arabidopsis thaliana OX=3702 GN=CSLA14 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999833	0.000169

TMHMM  Annotations     

Start	End
55	77
82	104
400	422
442	464
471	493