CAZyme Information: PMAA_093590-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_093590-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: alpha-N-acetylglucosaminidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	DS995902|CGC9	85332.15	4.5644

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:929435-931880(+)

Full Sequence      

MQILNLISGVLAIASTAIAAPGSTSTSTSSQLSTTGIESLLQRRLPQHAHKFEFSVVNAT
SLGENDAYTVANAENGRIKVEGSSLSALATGLHRYLADVAHVDIYWFIGSRLDQISAGQL
PKLNETLTGSSVVPYRYHFNTVTTSYTSAFWSWEDWELQLDWMALRGVNLPLAWIGVEKI
FIEVFQELGLTDAEISDFLSGPAFLAWNHFGNIQGSWGSPLPYAWVDSQFDLQKKIVKRM
VELGMTPILPAFPGFVPRAITRVLPDADVINGSAWEAFPAMFTSDTFMEPTDPHFTEIQK
SFISKQTAAYGNVTTFYTLDQFNENNPSSGDLNYLRSVSHGTWQALKAADPSAVWVMQGW
LFFSNSAFWTNDRVEAYLGGVTVDSDLLVLDLASESQPQWQRTNSYFGKPWIWCQIHDYG
GNMGFYGQVMNITVNPIAALNNATASLVGFGLSMEGQEGNEVVYDLLLDQAWSAKPIDTA
TYFHDWVTARYAGSKSIPTDVYSAWDMLRTSVYNNTNLASNAVPKAIFELIPSTTGLVNR
TGHHPTTLNYNPADMVKAWSLFYSAAFKEPSLWLNPAYEFDLVDMSRQVLANAFIPVYHD
LIAAWNTTNPSTIRIQIIGAELIGILQAIDTILDTNEHFKLSTWISAARTSAGEQSLEDF
LEYNALNQITLWGPTGQISDYASKSWAGLVSSYYIPRWKMFIEYLVDTKPAQYNQTAFKA
ELLKWELQWQNDTIAAATKNGAEDNKSAGGVEWVLLGLVGLWKDIFAA

Enzyme Prediction     

No EC number prediction in PMAA_093590-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	75	741	7.5e-210	0.9773755656108597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	0.0	136	474	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	4.41e-86	482	739	1	248	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	3.19e-24	36	113	2	75	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19502.1|GH89	0.0	1	768	1	768
QKX62920.1|GH89	0.0	33	767	20	754
UKZ51971.1|GH89	0.0	34	766	25	746
QYS99001.1|GH89	0.0	34	766	24	745
UKZ88341.1|GH89	0.0	29	766	20	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	2.46e-145	37	739	9	706	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.30e-91	51	731	189	848	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.51e-91	51	731	197	856	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.40e-90	51	731	212	871	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	3.46e-144	37	739	32	729	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	5.45e-131	40	729	52	770	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000389	0.999568	CS pos: 19-20. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in PMAA_093590-t26_1-p1.