CAZyme Information: PMAA_091290-t26_2-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_091290-t26_2-p1
• CAZy Family: GT2
• CAZyme Description: protein phosphatase regulatory subunit Gac1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		75682.07	9.2334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:259458-261890(+)

Full Sequence      

MSDSRLNSHHWLCDISLYTMPYTSPLQMSSAAPPHLAQTPVTSESLSHMHTHSPSPETSS
ASSSHSSHSLPHAHPQRQTLPRSSFSSQSYLRRHRRSPSYSKISLPPAGEGNSTDRTLLS
MTVDPHASLRQSPPPRNNAIIPSGAVISPPESAGNSSDEEGLPTDVRHMDLIDAAIRTLN
AQKKNEEREEKKQPSPMAGVVPALTPEARKISHSRSSTEGSLLITDSIETSSESDRDGDD
EGPKPPMVRKKSGELVRPALRSRRRPSSMPGTPTFSKNVHFDAQLEHIRHFLQLDKPLAV
SANTSPVETYCEEHEYPFTRPQPSAEWEIKLPNFPSNPATRKQQPVRLERVFLSPDHKNL
VGVVSVANLAFQKHVVARFTVDYWKTVSEVTAEYNHDVRKKQAHHGFDRFDFSIKLSDIT
DLGSKTLQVCIRYIVAGQEYWDNNDSMNYQIQFVKSEKTKTSDKNQQPTRAGARTLPRSR
NNPSTATRPRSMPPASFGEFGPSLDGSDRRDDSLGFRLTAVDSHDLFEAPKPREKPGRQA
FGNRYDFGLSLSAARSSGATEDRTTLSAKAKSMSSRGESVSTVHAHPRDAFQSSAIGKPH
LESPTYKELVDKYCFFGSPKVEGSLNSSKSNSGSVSPDNISRVDSGVAMNLQAENEPSNS
GMNSFNGSPIIFNTMYRSSPSIGIHV

Enzyme Prediction     

No EC number prediction in PMAA_091290-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	343	451	4.3e-33	0.9813084112149533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	4.07e-50	341	452	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	3.11e-07	368	451	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19725.1|CBM21	0.0	20	686	1	667
QKX59775.1|CBM21	2.80e-204	75	617	21	569
BCS08756.1|CBM21	1.16e-156	20	626	1	624
BCR96239.1|CBM21	1.16e-156	20	626	1	624
CAP80870.1|CBM21	4.02e-150	84	619	44	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	1.54e-09	358	451	46	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5U2R5|PPR3C_RAT	1.97e-10	312	454	130	259	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q7TMB3|PPR3C_MOUSE	2.63e-10	312	454	130	259	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|P40187|PIG2_YEAST	3.74e-10	344	457	390	513	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
sp|Q0VCR4|PPR3C_BOVIN	6.35e-10	321	454	139	259	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
sp|Q9UQK1|PPR3C_HUMAN	8.41e-10	321	454	139	259	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PMAA_091290-t26_2-p1.