CAZyme Information: PMAA_090480-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_090480-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: GMC oxidoreductase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		69118.69	4.8483

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995902:44969-46894(-)

Full Sequence      

MPSINLGLTKLALVTAVVSTVAAQGPQHLNFFDYGQRGPLLASHLGPPAPNATFDYVIAG
GGNAGLTIATRLAQTGASVAVIEAGGFYEVDNGNLSIVPGYATYFTGSDLDNYSPLVDWG
FATTPQAPLGNRRLHYARGKTLGGSSARNYMLYQRATVDSMQQWADEVDDQSYTWDAFLP
YYQKFINYTPPDQTLYTNSSNEQDPNAFNATGGPLKVSFSNFVDPFGTWAQQAFIKANMS
EIEGFDSGKLLGSAYATLTIDPSNAWRETPESSFLNYAFNAGLPLTVYKSSLAQKILFDS
NKTAIGVQVSAAGFFGTPSINFTLTARKEVILSAGAFQSPQLLMISGIGPCAELAAFNIP
CISNLTGVGQNMQDHPIFGIAHRVIVNTASASLNNATLSALSVQSYIRNATGPLSIFGPG
IYGWEKLPEPYRSQLSHQSRKVLDSTFPLDWPEIEWLPVAAYNGYNLNKQTADPCDGHNY
ATLNVALVAPLSRGTVKLQSNSMTHPPIIDPNWLADPTDLDLAIQSFKRQREIWSILADL
GVADKTEAFPGSNYTTDSQIQQIIVESMTTVYHASATCKMGNNGDPMAVLDSDARVYGVQ
NLRVVDASSFPFLPPGHPQALVYALAEKVADLISTQSISSL

Enzyme Prediction     

No EC number prediction in PMAA_090480-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	53	634	4.3e-168	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.44e-90	47	633	1	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	9.04e-88	53	633	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.58e-40	490	628	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.13e-28	11	622	9	565	Protein HOTHEAD
366272	GMC_oxred_N	3.32e-20	130	377	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA19805.1|AA3_2	0.0	1	641	1	641
QMW37598.1|AA3_2	2.68e-288	22	633	14	624
QMW25513.1|AA3_2	2.68e-288	22	633	14	624
QRD88504.1|AA3_2	2.68e-288	22	633	14	624
UCK57946.1|AA3_2	2.68e-288	22	633	14	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.02e-59	51	636	3	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	2.06e-55	54	633	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.00e-55	52	633	1	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	2.31e-53	54	636	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.18e-53	54	636	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	6.09e-195	19	634	15	625	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	9.84e-194	7	634	6	625	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.44e-161	8	633	6	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.87e-161	51	633	38	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	2.31e-156	40	631	32	591	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999732	CS pos: 23-24. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in PMAA_090480-t26_1-p1.