CAZyme Information: PMAA_089910-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_089910-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: glucooligosaccharide oxidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		51080.16	4.2174

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:3614299-3615804(+)

Full Sequence      

MGNTTSAVVQQCLLNAVGNDASRVAFPTTLLYETVDVNPYNLDYPVTPAAVTFPESAGQV
AAIVKCAVNADVKVQAKSGGHSYANYGLGGEDGAIVVDMRHFQQFSYDPTTQYATIGAGT
LLGDIDTRLHDAGGRAMTHGTSPQVGIGGHATIGGLGPTARQYGMALDHVESVQVVLANS
SIVTASTIEYPDIFYAIKGAGASFGVVTEFTVRTEAEPGIAVQYQFTFNLGDTISRANTF
KAWQQFVSDPTIPREFSCQLVLAEGLLLIEGEFFGSLADFEALQLESKFPANQGYNVTVF
NDWLALVAAWGVQLGEDLTGGIPSHFYSKSLPFTNTTLIPDGVVDEFFEYIDTADKGTLL
WFIIFDLEGGAISDVPVHATSYGHRDALFWLQSYGINLLGHVSATTNTFLNQVNNIFYTG
MPNAIFGAYPGYVDRELTNGPEQYWGPNLNTLIEIKSAVDPQDIFHNPQSVPLQ

Enzyme Prediction     

No EC number prediction in PMAA_089910-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	39	306	1.3e-69	0.5764192139737991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.37e-33	30	474	11	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	2.59e-30	48	186	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	2.04e-10	428	472	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	2.14e-08	46	208	63	232	cytokinin dehydrogenase
178402	PLN02805	8.92e-07	48	222	134	312	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17347.1|AA7	0.0	1	474	1	474
QRD00400.1|AA7	1.28e-175	1	471	1	472
CAE7010772.1|AA7	2.50e-174	1	471	1	475
QMW42271.1|AA7	5.04e-173	1	471	1	471
QMW30198.1|AA7	2.88e-172	1	471	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	1.46e-73	7	471	25	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3HSU_A	8.34e-63	35	471	30	476	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	1.63e-62	35	471	30	476	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6EO4_A	7.08e-62	1	474	5	471	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
3RJ8_A	1.21e-61	24	471	14	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	5.70e-119	12	472	10	468	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	7.52e-73	7	471	25	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	7.67e-62	35	471	49	495	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	3.75e-61	5	471	21	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|I1S2K2|CHITO_GIBZE	9.99e-60	36	471	49	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PMAA_089910-t26_1-p1.