CAZyme Information: PMAA_089240-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_089240-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: aryl-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		67398.77	6.5502

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:3457675-3459792(+)

Full Sequence      

MSSGRVSLTPTLEQKHNGVPARLLHKAQRAKSLIHDIATKKTKARQRLPVVPQGIDRDRF
VRALEELANDIGKEHVQVNDKPLEDGWYMESPNTHDGMAVTDEEELVASAVVYPGDTEDV
QKIVIWANKYLVPLHPISMGRNFGYGGAAPRVRGAVVIDLGKRMNKILNIDPDDCTCLVE
PGVSYYAMYEEMQKRGYKHLWLDVPDLGGGSMVGNALDHGVGYTPYGDHFGIHSGMEVVL
PTGEVVRTGMGALPGNNTWQLFQYGYGPYIDGIFTQSNFGIVTKMGFGLMPDPGGHESFL
YTFKNEEDLGPLVEIVRPLRIAMILDNIANIRHALQLLALSGKPRSTFYDGDGPFPMDKM
KEHLKSHPYGECTWVYFGTCYGPKEVRQLKLDTIHREFTKIPGAKRIDPSTLPPTDYFWS
RDKIASGEPDLEELAWVNWWPNGGHIAFSPVSPTRGADAMKLWHMAKKQWEASGLDFFLD
FIVGLRELHLVVEAVYDRDDAKQRDIALGVMRTLIDDAAKEGYGEYRTHLLLSDQVAGTY
SWNNSALMKLNEKMKDCLDPNGILAPGRNGIWPARYRGRGWELYTNRASSEGNGVAPPAG
ATRL

Enzyme Prediction     

EC	1.1.3.38:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	50	581	1.8e-228	0.9923371647509579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.13e-28	108	249	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.47e-28	107	569	31	455	FAD/FMN-containing dehydrogenase [Energy production and conversion].
178402	PLN02805	1.48e-09	107	252	133	274	D-lactate dehydrogenase [cytochrome]
183043	PRK11230	5.31e-07	55	334	16	275	glycolate oxidase subunit GlcD; Provisional
237553	murB	0.007	112	197	35	114	UDP-N-acetylmuramate dehydrogenase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17285.1|AA4	0.0	1	604	1	604
CAP97133.1|AA4	0.0	1	604	1	604
BCS28228.1|AA4	0.0	1	604	1	604
QGA20504.1|AA4	4.92e-304	1	604	1	604
AEO67281.1|AA4	2.12e-295	10	597	12	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E8F_A	7.89e-172	51	583	12	560	Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8F_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8G_A STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8G_B STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8H_A Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum],1E8H_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum]
1E0Y_A	3.17e-171	51	583	12	560	Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1E0Y_B Structure of the D170S/T457E double mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1W1K_A	6.35e-171	51	583	12	560	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1DZN_A	8.98e-171	41	583	3	560	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1AHU_A	1.80e-170	51	583	12	560	Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHU_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHV_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHV_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHZ_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1AHZ_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],1VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],2VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],2VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	9.26e-170	51	583	12	560	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	1.09e-110	50	571	8	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
sp|P94535|GLCD_BACSU	8.95e-12	101	305	34	229	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1
sp|Q12627|DLD1_KLULA	9.00e-09	52	196	92	232	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=DLD1 PE=3 SV=2
sp|Q9EQR2|ADAS_RAT	5.09e-08	105	361	189	442	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Rattus norvegicus OX=10116 GN=Agps PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PMAA_089240-t26_1-p1.