CAZyme Information: PMAA_086840-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_086840-t26_1-p1
• CAZy Family: GH92
• CAZyme Description: choline oxidase (CodA), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		60058.49	6.2943

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:2788947-2790624(+)

Full Sequence      

MATTVLLPPSELDSYDYAIVGGGTAGCVIASRLAEYLPNKRILLIEAGPSDYMDDRVLNL
KEWLSLLGGELDYDYPTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDLRLWQES
GCTGWSFDMFTRVLDNLRNTIQPVHARHRNQLCKDWVQSCSTALKIPIIEDFNKEIRSKG
ELEQGVGFFSVSYNPDDGRRSSASVAYIHPILRAEEKRPNLTILTNAWVSRLNVDGDTVT
GIDVTLESGKKYTLNPKIETILCAGAIDTPRLMLLSGLGPKEQLSSLGIPVVKNIPGVGE
NLLDHPETIIIWELNQPVPPNQTTMDSDAGIFLRREPPNAAGSDGTAADLMMHCYQIPFC
LNTTRLGYDEPVDAFCMTPNIPRPRSRGRLYLTSSDPNVKPALDFRYFTDPEGYDAATIV
AGFKAAREVAKQAPFKDWIKREVAPGPSVVTDEALSEYGRRVAHTVYHPAGTTKMGNIER
DPLAVVDPQLRVRGLKKIRVADASVFPHMTTINPMLTVLGIGERAAELIAEDAGWKRNQP
RL

Enzyme Prediction     

No EC number prediction in PMAA_086840-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	539	8.2e-90	0.5161812297734628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.18e-118	14	534	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.41e-108	14	529	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.92e-44	384	525	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.37e-32	14	522	55	569	Protein HOTHEAD
366272	GMC_oxred_N	8.71e-24	15	307	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17054.1|AA3_2	0.0	1	542	1	542
ATQ35968.1|AA3_2	0.0	1	542	1	542
QKX54836.1|AA3_2	0.0	1	542	1	542
EAA64559.1|AA3_2	0.0	1	542	1	542
BCS03844.1|AA3_2	0.0	1	542	90	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.14e-122	15	529	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.61e-122	15	529	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	4.54e-122	15	529	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	7.18e-56	9	533	78	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.05e-55	9	533	2	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	5.88e-122	15	529	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	8.50e-75	13	530	5	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.71e-71	15	529	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	9.42e-71	10	529	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q4A0Q1|BETA_STAS1	1.15e-69	13	529	3	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000004

TMHMM  Annotations     

There is no transmembrane helices in PMAA_086840-t26_1-p1.