CAZyme Information: PMAA_085030-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_085030-t26_1-p1
• CAZy Family: GH89
• CAZyme Description: alpha 1,2-mannosyltransferase Smp3, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		60925.99	8.5264

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:2296158-2297981(+)

Full Sequence      

MWRRTYLLLLLVRIYFALSPSYVHPDEHFQSLEVFAGRIYSYPSQLTWEFTSENPIRSVF
PLWPVYGLPMNLLKWFYDETALGSSPPPELIYYILRGVMLVLSFVLEDWAVYELVPTPRY
RVPTVVLVASSYVTWTYQTHTFSNSLETLLVTWGLVLIQRILENRKRSAFFSPAVLSLVV
VLGVFNRITFPAFLLIPGLQLIPHFIQKPFSFAVLAGCGSLFSAIAILTDTIFYRSSSLI
ESIRHPVIAPLNNLIYNSNSQNLAQHGLHPFYHHFLVNLPQLLGPALVVLVVSLFMKPTI
RSATFYNRRAISAISGTMILSAIPHQEPRFLLPCVPLLLTCIRPVKTRPFLVSWIAFNAI
LGFLMGVYHQGGVVPTQLAMPSIVSSTMAQRTQNDKLNVTVFWWKTYSPPLWLLGDNSEL
QADIQTRDLMGMRGADMIKEIDSTVPTCPSLLSSSKDRNNLIFLVAPRSATFLDTYTSAS
ASSSSDAPPQLNLTEQWTYPNHLNLDDMDFGDDGFISTIYRVIGRRGLTVWSVERIGCL

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	413	3.7e-85	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	2.16e-54	5	412	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	6.71e-05	3	339	39	351	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16879.1|GT22	0.0	1	539	1	539
QKX60855.1|GT22	1.13e-267	1	539	1	538
BCS03934.1|GT22	5.09e-249	1	539	1	537
BCS15543.1|GT22	5.09e-249	1	539	1	537
QRD88744.1|GT22	1.17e-238	1	538	1	538

PDB Hits     

PMAA_085030-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WTT7|SMP3_ASPFU	2.40e-240	1	538	1	546	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	4.56e-237	1	538	1	542	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	1.36e-234	1	538	1	541	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q4I785|SMP3_GIBZE	2.04e-177	1	535	1	513	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q6BJ96|SMP3_DEBHA	2.62e-92	2	512	9	521	GPI mannosyltransferase 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=SMP3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999728	CS pos: 25-26. Pr: 0.7661

TMHMM  Annotations     

Start	End
175	197
210	232
274	296
350	372