CAZyme Information: PMAA_084270-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_084270-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: mannan polymerase II complex ANP1 subunit Anp1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		59009.44	5.6242

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:2073172-2074906(+)

Full Sequence      

MNRQFAYPKGYSAYPRGGGGTFSISPHRFQPRSQPALLRRRQLLIKLPAIAGLSLLVLFF
LIPSWRAIILPTLSFGLFSTTRDDLSLETVRYYDLSDVQGTAMGWHREERVLMCTPLRDA
QAHLPMFFSHLRNLTYPHHLIDLAFLVSDSKDNTLNLLSSLLTELQNDEDPKMPFGEISV
IEKDFGQQVNQDVESRHGFAAQASRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPF
TILEDLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALADSLDEDAVIVEGY
AEYATWRPHLAYLRDPFGDPDMELEIDGVGGVSILAKAKVFRSGVHFPAFSFEKHAETEG
FGKMAKRMKYSVVGLPHYTIWHLYEPSVDDLRHMEEMEQEKKQREAKEKAEKAEAERQQI
LKDQLKDSTDEREKDGKQQIDKTEQTEQMERVEKAHPKAAAGEKVDSGIENERRPAIPAK
GENEAADAGPVPKDSKSNTEEKTRQDSSNNHNEKLQE

Enzyme Prediction     

No EC number prediction in PMAA_084270-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	88	351	7.3e-124	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	6.16e-154	89	351	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16802.1|GT62	0.0	1	517	1	517
QKX57946.1|GT62	3.47e-262	1	436	1	433
QRD89585.1|GT62	7.94e-247	1	396	1	395
UDD59518.1|GT62	2.75e-246	1	396	1	395
QSS53764.1|GT62	4.82e-245	6	437	6	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.36e-61	90	387	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	2.76e-157	89	397	61	369	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	4.18e-157	19	397	11	386	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	9.39e-123	89	394	171	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	3.31e-119	81	397	67	433	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	5.27e-65	76	385	54	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999887	0.000123

TMHMM  Annotations     

Start	End
47	69