CAZyme Information: PMAA_082960-t26_1-p1

Basic Information

• Species: Talaromyces marneffei
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces marneffei
• CAZyme ID: PMAA_082960-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: class III chitinase ChiA1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		84599.49	4.6579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TmarneffeiATCC18224	10194	441960	145	10049

• Gene Location: location=DS995901:1729875-1732550(+)

Full Sequence      

MSPVTAAGVTFAGLTSVATYYGQGAYQPRLSTFCAETSLDIINIGFVNYFPDAGAAGWPQ
TNFGNQCDGTVYTHNGQSTGLLANCHQIVEDIPLCQKAGKKILLSLGGAGPEIGQYIASQ
QSAVAFAEWLWGAFGPIDSPYAGLDVPRPFRGIVVDGFDFDIEWGTDYGYGYMANRFKEL
YDEYNQQMSTSRKWLLSAAPQCVIPDAHLASAIHDAPFDYIWVQFYNDGHCAAANYVNGI
SGFNFDEWVSAIQASANPNAKLYVGLGAEPEQVRSGFYVDPEAVAPLVHEYMNKYPSTFG
GIMLWEATGSLNNTTPDGNTYADNMKEILVHYATTIAPSPTPTPTPTPTPPPSTSASVSS
AATSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVVTPTPTPTPTPSGSSSSSSSSSSSSSS
AAVSSSSDAVSSSASSSAASSSSAAVSSSSSAVSSSPAASSTAVRPTTRSSCTRKTPSPS
SPAVISTPSPSSPAVVSTPSPSSPAVVSTPSPSSPAVVSTPSPSSPAVVSTPSPSSPAVV
STPSPSSPAVVSTPSPSSPAVVSTPSPSSPAVVPSSTAVPPPSGGSTSTGSATETSPASV
GPTGTSSIPGSGSVTSGVSVPATTGPLTDTSSAVATSTGTESWTTTVVTTSYVYVCPTGL
ATSTITYTESYCPCTATAGASTAVPTGWTTTTAVCTVCGPQPTTVTLTLPPQVSATSTAL
PGSNPGPLPGTGSSKTSGTNPNTGSQTSGPAPGSGSKPSESSGKPGSGSAPGNGAQPSST
STVVPGVGAVGKSGPYPSTSTATTITARPSASSFPKSSSTQTSVSPAFTGAAGRASLSPV
VGGIVLVASLFALL

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	17	268	1.2e-21	0.6486486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	2.51e-103	15	327	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.90e-14	17	266	2	220	Glycosyl hydrolases family 18.
223021	PHA03247	1.39e-13	477	809	2551	2881	large tegument protein UL36; Provisional
223021	PHA03247	1.52e-13	465	785	2662	2989	large tegument protein UL36; Provisional
223039	PHA03307	5.21e-13	465	842	83	430	transcriptional regulator ICP4; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX61203.1|GH18	2.72e-135	4	338	11	345
CAK40432.1|GH18	4.73e-113	15	330	28	337
BCS11270.1|GH18	2.13e-112	15	330	28	337
BCR90928.1|GH18	3.19e-110	15	338	28	346
AAO61685.1|GH18	7.37e-109	15	331	29	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	7.71e-117	15	331	1	309	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	7.98e-117	15	331	2	310	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	7.98e-117	15	331	2	310	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	2.18e-51	15	335	6	293	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	1.23e-38	17	311	3	259	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QUQ2|CHIA1_ASPNC	8.40e-114	15	330	28	337	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|Q873Y0|CHIA1_ASPFM	1.31e-109	15	331	29	337	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	1.43e-109	15	331	29	337	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|G5EB30|CHIA1_EMENI	1.07e-90	15	329	28	336	Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiA PE=1 SV=1
sp|Q92223|CHIA1_EMEND	1.07e-90	15	329	28	336	Endochitinase A OS=Emericella nidulans OX=162425 GN=chiA PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.876738	0.123271

TMHMM  Annotations     

There is no transmembrane helices in PMAA_082960-t26_1-p1.